DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKII and dclk1

DIOPT Version :9

Sequence 1:NP_001162833.1 Gene:CaMKII / 43828 FlyBaseID:FBgn0264607 Length:531 Species:Drosophila melanogaster
Sequence 2:XP_012812605.1 Gene:dclk1 / 733926 XenbaseID:XB-GENE-960590 Length:753 Species:Xenopus tropicalis


Alignment Length:347 Identity:127/347 - (36%)
Similarity:191/347 - (55%) Gaps:18/347 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 SDNYDIKEELGKGAFSIVKRCVQKSTGFEFAAKIINTKKLTARDFQKLEREARICRKLHHPNIVR 75
            |:.|.:...:|.|.|:|||.|:::|||.|:|.||||..|...:: ..::.|..|.|::.|||||.
 Frog   400 SERYKVGRTIGDGNFAIVKECIERSTGREYALKIINKSKCRGKE-HMIQNEVSILRRVKHPNIVL 463

  Fly    76 LHDSIQEENYHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESVNHCHQNGVVHRDLKPE 140
            |.:.:...:..|||.:||.||:||:.|.:...|:|.||:..:..::.::.:.|...:||||:|||
 Frog   464 LIEEMDMPSELYLVMELVKGGDLFDAITSTNKYTERDANGMLYNLMSAIKYLHSLNIVHRDIKPE 528

  Fly   141 NLLLASKAKGA-AVKLADFGLAIEVQGDHQAWFGFAGTPGYLSPEVLKKEPYGKSVDIWACGVIL 204
            |||:.....|: ::||.|||||..|.|   ..:...|||.|::||::.:..||..|||||.|||.
 Frog   529 NLLVYEHQDGSKSLKLGDFGLATVVDG---PLYTVCGTPTYVAPEIIAETGYGLKVDIWAAGVIT 590

  Fly   205 YILLVGYPPF--WDEDQHRLYSQIKAGAYDYPSPEWDTVTPEAKNLINQMLTVNPNKRITAAEAL 267
            ||||.|:|||  ..:||..|:.||..|..|:|||.||.|:..||.||..||.|:.::|.:|.:.|
 Frog   591 YILLCGFPPFRGSGDDQEVLFDQILMGHMDFPSPYWDNVSDSAKELITMMLQVDVDQRYSALKVL 655

  Fly   268 KHPWI-----CQRERVASVVHRQETVDCLKKFNARRKLK-GAILTTMLATRNFSSRSMITKKGEG 326
            :|||:     .:.|...||..:.:     |.||...|.. .:....::||........:.::...
 Frog   656 EHPWVNDDGLPENEYPLSVAGKIK-----KHFNTGPKPNCNSAGVNVIATTALDKERQVFRRRRN 715

  Fly   327 SQVKESTDSSSTTLEDDDIKED 348
            ..|:....|.....|.:...||
 Frog   716 QDVRYRFGSHQAAPEFNSESED 737

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKIINP_001162833.1 STKc_CaMKII 12..303 CDD:270988 119/299 (40%)
S_TKc 14..272 CDD:214567 111/260 (43%)
CaMKII_AD 390..517 CDD:285524
dclk1XP_012812605.1 DCX1_DCLK1 55..143 CDD:340660
DCX2 182..265 CDD:340589
STKc_DCKL1 396..663 CDD:271085 113/266 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.