DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKII and Stk33

DIOPT Version :9

Sequence 1:NP_001162833.1 Gene:CaMKII / 43828 FlyBaseID:FBgn0264607 Length:531 Species:Drosophila melanogaster
Sequence 2:XP_008758045.2 Gene:Stk33 / 690861 RGDID:1590972 Length:508 Species:Rattus norvegicus


Alignment Length:400 Identity:116/400 - (28%)
Similarity:184/400 - (46%) Gaps:55/400 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 YDIKEELGKGAFSIVKRCVQKSTGFEFAAKIINTKKLTARDFQKLEREARICRKLHHPNIVRLHD 78
            |.....||:|:|.:|.....|.||.::|.|.:|.:|..:...:.||||..|.:.:.|.:|:.|..
  Rat   112 YTFGRILGQGSFGMVIEATDKETGAKWAIKKVNKEKAGSSAVKLLEREVNILKTVKHQHIIHLEQ 176

  Fly    79 SIQEENYHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESVNHCHQNGVVHRDLKPENLL 143
            ..:.....|||.:|...|||.|.:..|..:||::....||.:..::.:.|...:||||||.||::
  Rat   177 VFESPQKMYLVMELCEDGELKEVLDQRGHFSESETRLIIQSLASAIAYLHSKDIVHRDLKLENIM 241

  Fly   144 LAS------KAKGAAVKLADFGLAIEVQGDHQAWF--GFAGTPGYLSPEVLKKEPYGKSVDIWAC 200
            :.|      ......:|::|||||::..|......  ...|||.|::|||:....|.:..|||:.
  Rat   242 VKSSFIDDNNEMNLNIKVSDFGLAVQKHGSRSESMMQTTCGTPIYMAPEVINAHDYSQQCDIWSI 306

  Fly   201 GVILYILLVGYPPFWDEDQHRLYSQIKAGAYDYPSPEWDTVTPEAKNLINQMLTVNPNKRITAAE 265
            |||:||||.|.|||....:.:|:..|:.|...:..|.||:|:..||:.:.|::.|:|..||||.|
  Rat   307 GVIMYILLCGEPPFLANSEEKLFELIRKGELQFQDPVWDSVSDSAKSALKQLMKVDPAHRITAKE 371

  Fly   266 ALKHPWI----CQRERVASVV-------HRQETVDCLK-----KFNARRKLKGAILTTMLATRNF 314
            .|.:.|:    ....|..:|:       :..|:.|..|     :.:...|||             
  Rat   372 LLDNQWLTGNTLSSARPTNVLEMMKEWKNNPESDDDTKADKETEQHTEEKLK------------- 423

  Fly   315 SSRSMITKKGEGSQVKESTDSSSTTLEDDDIKEDKKGTVDRS----------TTVVSKEPE---- 365
              .:.|.:|  ...|..|..:.|.....|:.|:....:||.|          :..:..|||    
  Rat   424 --HNKIEEK--APNVNHSPSAKSVNQPTDEAKKPDADSVDMSPSDSTSYKLISAEIKAEPEKSSG 484

  Fly   366 DIRILCPAKT 375
            .:..:..|||
  Rat   485 SVSHVAVAKT 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKIINP_001162833.1 STKc_CaMKII 12..303 CDD:270988 100/312 (32%)
S_TKc 14..272 CDD:214567 91/265 (34%)
CaMKII_AD 390..517 CDD:285524
Stk33XP_008758045.2 PKc_like 110..378 CDD:419665 91/265 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.