DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKII and stk33

DIOPT Version :9

Sequence 1:NP_001162833.1 Gene:CaMKII / 43828 FlyBaseID:FBgn0264607 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_001038554.2 Gene:stk33 / 565828 ZFINID:ZDB-GENE-040724-242 Length:500 Species:Danio rerio


Alignment Length:370 Identity:109/370 - (29%)
Similarity:189/370 - (51%) Gaps:22/370 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 TRFSDN------YDIKEELGKGAFSIVKRCVQKSTGFEFAAKIINTKKLTARDFQKLEREARICR 66
            ||..|.      |....:||:|:|.:|.......|..::|.|.:|.:|......:.||||..|.:
Zfish    36 TRIEDESSIQKIYSFGRKLGQGSFGVVCEATHIETQRKWAIKKVNKEKAGTSGVKHLEREVSIMK 100

  Fly    67 KLHHPNIVRLHDSIQEENYHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESVNHCHQNG 131
            ::.|.:|:.|.:..:.....|||.:|..||:|.:.:...:.::|.:..|.|:.:.|::.:.|:..
Zfish   101 QVKHEHIIHLEEVFETPKRMYLVTELCEGGDLKDLLQKNKHFTEEETRHIIKSLSEAIVYLHKKD 165

  Fly   132 VVHRDLKPENLLLASKAKG-----AAVKLADFGLAIEV--QGDHQAWFGFAGTPGYLSPEVLKKE 189
            :||||||.||:|:.|..:|     ..:|:.||||:::.  .|.........|||.|::|||:...
Zfish   166 IVHRDLKLENILVKSCHQGNDNDMVNIKVTDFGLSVQKGGVGSENMLQATCGTPIYMAPEVVNGH 230

  Fly   190 PYGKSVDIWACGVILYILLVGYPPFWDEDQHRLYSQIKAGAYDYPSPEWDTVTPEAKNLINQMLT 254
            .|.:..|:|:.|||:|:||.|.|||....:.||...|..|...:..|.|:|::..|||:|..:|.
Zfish   231 QYSQQCDLWSIGVIMYMLLCGEPPFGSSSKERLSEMIMKGELTFSGPVWNTISDAAKNVIRCLLK 295

  Fly   255 VNPNKRITAAEALKHPWICQRERVASVVHRQETVDCLKKFNARRKLKGAILTTMLATRNFSSRSM 319
            |:|..||||.|.|.:|||  ....::.|.|...::.:::|  |...:..::..  .:....|.|:
Zfish   296 VDPAHRITANELLDNPWI--SGDTSTAVTRTNVLEMMRQF--RNAPEDEVIGE--TSEGLHSLSL 354

  Fly   320 ITKKGEGSQVKESTDSSSTTLEDDDIKEDKKGTVDRSTTVVSKEP 364
            .:.:.:||..:.|.:.|.|....:|:.:...|:   ..:..:|:|
Zfish   355 SSSQDKGSGPRTSQELSVTPATSEDVTDSSNGS---KPSTPNKKP 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKIINP_001162833.1 STKc_CaMKII 12..303 CDD:270988 96/303 (32%)
S_TKc 14..272 CDD:214567 89/264 (34%)
CaMKII_AD 390..517 CDD:285524
stk33NP_001038554.2 PKc_like 46..313 CDD:304357 89/266 (33%)
S_TKc 48..313 CDD:214567 89/264 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.