DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKII and dclk1a

DIOPT Version :9

Sequence 1:NP_001162833.1 Gene:CaMKII / 43828 FlyBaseID:FBgn0264607 Length:531 Species:Drosophila melanogaster
Sequence 2:XP_005172728.1 Gene:dclk1a / 558997 ZFINID:ZDB-GENE-061013-124 Length:770 Species:Danio rerio


Alignment Length:330 Identity:126/330 - (38%)
Similarity:181/330 - (54%) Gaps:10/330 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PAACTRFSDNYDIKEELGKGAFSIVKRCVQKSTGFEFAAKIINTKKLTARDFQKLEREARICRKL 68
            |...:..||.|.:...:|.|.|::|..||:.||...:|.||||..|...:: ..::.|..|.|::
Zfish   373 PTVPSSISDRYKVGRMIGDGNFAVVHECVEHSTDRAYALKIINKGKCRGKE-HMIQNEVAILRRV 436

  Fly    69 HHPNIVRLHDSIQEENYHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESVNHCHQNGVV 133
            .|||||.|.:.:...|..|||.:||.||:||:.|.:...|:|.|||..:..:..::.:.|...:|
Zfish   437 KHPNIVLLIEEMDTYNELYLVMELVKGGDLFDAITSANRYTERDASGMLYNLASAIKYLHSLNIV 501

  Fly   134 HRDLKPENLLLASKAKGA-AVKLADFGLAIEVQGDHQAWFGFAGTPGYLSPEVLKKEPYGKSVDI 197
            |||:||||||:.....|: ::||.|||||..|.|   ..:...|||.|::||::.:..||..|||
Zfish   502 HRDIKPENLLVYEHQDGSKSLKLGDFGLATVVDG---PLYTVCGTPTYVAPEIIAETGYGLKVDI 563

  Fly   198 WACGVILYILLVGYPPF--WDEDQHRLYSQIKAGAYDYPSPEWDTVTPEAKNLINQMLTVNPNKR 260
            ||.|||.||||.|:|||  ..|||..|:.||..|..::|.|.||.|:..||.||..||.|..::|
Zfish   564 WAAGVITYILLCGFPPFRGSTEDQEALFDQILLGQLEFPLPYWDNVSDSAKELIVSMLQVEVDQR 628

  Fly   261 ITAAEALKHPWICQRERVASVVHRQETVDCLKK-FNARRKLKGAILTTMLATRNFSSRSMITKKG 324
            .||.:.|:|||: ..:.::...|:......:|| ||...|.....:|.|..|. ......|.::|
Zfish   629 YTALQVLEHPWV-TNDGLSENEHQLSVAGKIKKHFNTGPKPNTPGVTVMTTTA-LDKERQILRRG 691

  Fly   325 EGSQV 329
            ....|
Zfish   692 RHQNV 696

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKIINP_001162833.1 STKc_CaMKII 12..303 CDD:270988 118/294 (40%)
S_TKc 14..272 CDD:214567 110/260 (42%)
CaMKII_AD 390..517 CDD:285524
dclk1aXP_005172728.1 DCX 46..137 CDD:214711
DCX 174..262 CDD:214711
STKc_DCKL1 376..643 CDD:271085 113/271 (42%)
S_TKc 383..640 CDD:214567 110/260 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.