DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKII and PHKG1

DIOPT Version :9

Sequence 1:NP_001162833.1 Gene:CaMKII / 43828 FlyBaseID:FBgn0264607 Length:531 Species:Drosophila melanogaster
Sequence 2:XP_016867813.1 Gene:PHKG1 / 5260 HGNCID:8930 Length:432 Species:Homo sapiens


Alignment Length:361 Identity:119/361 - (32%)
Similarity:181/361 - (50%) Gaps:72/361 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 FSDNYDIKEELGKGAFSIVKRCVQKSTGFEFAAKIINTK---KLTARDFQKLE----REARICRK 67
            |.:||:.||.||:|..|:|:||:.|.|..|:|.|:|:..   ..:..:.::|.    :|..|.||
Human    16 FYENYEPKEILGRGVSSVVRRCIHKPTSQEYAVKVIDVTGGGSFSPEEVRELREATLKEVDILRK 80

  Fly    68 LH-HPNIVRLHDSIQEENYHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESVNHCHQNG 131
            :. ||||::|.|:.:...:.:|||||:..||||:.:..:...||.:....::.:||.:...|:..
Human    81 VSGHPNIIQLKDTYETNTFFFLVFDLMKRGELFDYLTEKVTLSEKETRKIMRALLEVICTLHKLN 145

  Fly   132 VVHRDLKPENLLLASKAKGAAVKLADFGLAIEVQ---------GDHQ------------------ 169
            :|||||||||:||.....   :||.|||.:.:::         |.|.                  
Human   146 IVHRDLKPENILLDDNMN---IKLTDFGFSCQLEPGERLRVETGFHHVGQAGLELLTLRSARLGL 207

  Fly   170 -------------AWFGFA----GTPGYLSPEVL-----KKEP-YGKSVDIWACGVILYILLVGY 211
                         |..|.:    |||.||:||::     :..| |||.||:|:.|||:|.||.|.
Human   208 PKCCDYRREPPCPAGLGISSEVCGTPSYLAPEIIECSMNEDHPGYGKEVDMWSTGVIMYTLLAGS 272

  Fly   212 PPFWDEDQHRLYSQIKAGAYDYPSPEWDTVTPEAKNLINQMLTVNPNKRITAAEALKHPWICQRE 276
            ||||...|..:...|.:|.|.:.|||||..:...|:|:::.|.|.|..|.||.|||.||:.    
Human   273 PPFWHRKQMLMLRMIMSGNYQFGSPEWDDYSDTVKDLVSRFLVVQPQNRYTAEEALAHPFF---- 333

  Fly   277 RVASVVHRQETVDCLKKFNARRKLKGAILTTMLATR 312
                   :|..|:.::.|:.|.|.|...||.:.:.|
Human   334 -------QQYLVEEVRHFSPRGKFKVIALTVLASVR 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKIINP_001162833.1 STKc_CaMKII 12..303 CDD:270988 115/348 (33%)
S_TKc 14..272 CDD:214567 108/315 (34%)
CaMKII_AD 390..517 CDD:285524
PHKG1XP_016867813.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.