DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKII and Lkb1

DIOPT Version :9

Sequence 1:NP_001162833.1 Gene:CaMKII / 43828 FlyBaseID:FBgn0264607 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_001163606.1 Gene:Lkb1 / 41673 FlyBaseID:FBgn0038167 Length:567 Species:Drosophila melanogaster


Alignment Length:281 Identity:80/281 - (28%)
Similarity:132/281 - (46%) Gaps:41/281 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 YDIKEELGKGAFSIVKRCVQKSTGFEFAAKIINTKKL--TARDFQKLEREARICRKLHHPNIVRL 76
            |.:.:.||:|::..||..:........|.||:..:||  .....|.:.||..:.::|.|.::|.|
  Fly   172 YIMGDVLGEGSYGKVKEAMNSENLCRLAVKILTKRKLRRIPNGEQNVTREIALLKQLKHRHVVEL 236

  Fly    77 HDSI--QEENYHYLVFDLVTGG-------------ELFEDIVAREFYSEADASHCIQQILESVNH 126
            .|.:  :|:...|||.:...||             .||:            |....:|:::.:.:
  Fly   237 VDVLYNEEKQKMYLVMEYCVGGLQEMIDYQPDKRMPLFQ------------AHGYFKQLVDGLEY 289

  Fly   127 CHQNGVVHRDLKPENLLLASKAKGAAVKLADFGLAIEVQ---GDHQAWFGFAGTPGYLSPEVLK- 187
            .|...|:|:|:||.||||   :....:|::|||:|.::.   .|.....| .|:|.:..||:.. 
  Fly   290 LHSCRVIHKDIKPGNLLL---SLDQTLKISDFGVAEQLDLFAPDDTCTTG-QGSPAFQPPEIANG 350

  Fly   188 KEPY-GKSVDIWACGVILYILLVGYPPFWDEDQHRLYSQIKAGAYDYPSPEW-DTVTPEAKNLIN 250
            .|.: |..||||:.||.||.|..|..||..::.:||...|..|.::  :|.| ..:..:..|||.
  Fly   351 HETFAGFKVDIWSSGVTLYNLATGQYPFEGDNIYRLLENIGRGQWE--APAWLYEMDADFANLIL 413

  Fly   251 QMLTVNPNKRITAAEALKHPW 271
            .||..:|:||::..|.....|
  Fly   414 GMLQADPSKRLSLQEIRHDTW 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKIINP_001162833.1 STKc_CaMKII 12..303 CDD:270988 80/281 (28%)
S_TKc 14..272 CDD:214567 80/281 (28%)
CaMKII_AD 390..517 CDD:285524
Lkb1NP_001163606.1 S_TKc 172..435 CDD:214567 80/281 (28%)
STKc_LKB1 178..435 CDD:271021 79/275 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452306
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.