DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKII and sqa

DIOPT Version :9

Sequence 1:NP_001162833.1 Gene:CaMKII / 43828 FlyBaseID:FBgn0264607 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_001260832.1 Gene:sqa / 36002 FlyBaseID:FBgn0259678 Length:888 Species:Drosophila melanogaster


Alignment Length:360 Identity:109/360 - (30%)
Similarity:189/360 - (52%) Gaps:30/360 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 NYDIKEELGKGAFSIVKRCVQKSTGFEFAAKIINTKKLTARDFQKLEREARICRKLHHPNIVRLH 77
            :||:..|:|:|.|..|.:|..|:.|.:.|||.:...|  ..|.:.:|||..|...|.|..|::|:
  Fly    33 HYDVLGEVGRGKFGTVYKCRDKANGLQLAAKFVPIPK--REDKRNVEREVEIMNSLQHHLIIQLY 95

  Fly    78 DSIQEENYHYLVFDLVTGGELFEDIVAREF-YSEADASHCIQQILESVNHCHQNGVVHRDLKPEN 141
            .:.:.:....:|.:|:.|||||:.:|..|| .:|......|:|:.|::...|.||:||.||||||
  Fly    96 AAYEYQKMMCVVLELIEGGELFDRVVDDEFVLTERVCRVFIRQVCEAMAFIHGNGIVHLDLKPEN 160

  Fly   142 LLLASKAKGAAVKLADFGLAIEVQGDHQAWFGFAGTPGYLSPEVLKKEPYGKSVDIWACGVILYI 206
            :|:.:: ||..:|:.|||||.:...|.:....| |||.:::|||:..:......|:|:.|||.|:
  Fly   161 ILVLTQ-KGNRIKIIDFGLARKFDPDKRLRVLF-GTPEFVAPEVVNFDCISYGTDMWSVGVICYV 223

  Fly   207 LLVGYPPFWDEDQHRLYSQIKAGAYDYPSPEWDTVTPEAKNLINQMLTVNPNKRITAAEALKHPW 271
            |:.|..||..|:.....|.:....||:....::.::||..:.|.::|..:.:.|:||||.:||.|
  Fly   224 LISGLSPFMGENDIETMSNVTIAKYDFEDECFNGISPECLDFIAKLLAKDLSTRMTAAECMKHKW 288

  Fly   272 ICQRERVASVVHRQETVDCLKKFNARRKLKGAILTTMLATRNFSSRSMITKKGEGSQVKESTDSS 336
            :.||...|                       |..|.:....:.:|:|.:......:...||::.|
  Fly   289 LQQRPATA-----------------------ATATPITKAASAASKSRLKSVSPVTAPSESSEDS 330

  Fly   337 STTLEDDDIKEDKKGTVDRSTTVVSKEPEDIRILC 371
            :.|:||:|  ::::..|.::.....::.|::..||
  Fly   331 TETIEDED--DEEEVAVQQAKQKDQQQDEELANLC 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKIINP_001162833.1 STKc_CaMKII 12..303 CDD:270988 94/290 (32%)
S_TKc 14..272 CDD:214567 90/258 (35%)
CaMKII_AD 390..517 CDD:285524
sqaNP_001260832.1 S_TKc 34..289 CDD:214567 90/258 (35%)
STKc_MLCK 40..289 CDD:271005 87/252 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24347
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.