DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKII and lok

DIOPT Version :9

Sequence 1:NP_001162833.1 Gene:CaMKII / 43828 FlyBaseID:FBgn0264607 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_477219.1 Gene:lok / 35288 FlyBaseID:FBgn0019686 Length:476 Species:Drosophila melanogaster


Alignment Length:269 Identity:99/269 - (36%)
Similarity:151/269 - (56%) Gaps:11/269 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 YDIKEELGKGAFSIVKRCVQKSTGFEFAAKIINTKKLT-AR------DFQKLEREARICRKLHHP 71
            |.:..:||.||:.:|:......|..:||.||:....|: ||      |..::..||:|.:.|.||
  Fly   174 YYVNRKLGSGAYGLVRLVYDTRTCQQFAMKIVKKNMLSGARPSTNFSDPDRVLNEAKIMKNLSHP 238

  Fly    72 NIVRLHDSIQEENYHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESVNHCHQNGVVHRD 136
            .:||:||.:.:.:..|:|.:.:.||:|...|::.:..||..:.....|:..:|.:.|..|:.|||
  Fly   239 CVVRMHDIVDKPDSVYMVLEFMRGGDLLNRIISNKLLSEDISKLYFYQMCHAVKYLHDRGITHRD 303

  Fly   137 LKPENLLLASKAKGAAVKLADFGLAIEVQGDHQAWFGFAGTPGYLSPEVL---KKEPYGKSVDIW 198
            |||:|:||.:..:...:|::||||:..||.| .......|||.|::||||   .:|.|.|.||||
  Fly   304 LKPDNVLLETNDEETLLKVSDFGLSKFVQKD-SVMRTLCGTPLYVAPEVLITGGREAYTKKVDIW 367

  Fly   199 ACGVILYILLVGYPPFWDEDQHRLYSQIKAGAYDYPSPEWDTVTPEAKNLINQMLTVNPNKRITA 263
            :.||:|:..|.|..||.||.......|||.|.:.|..|.|.:|:..||.||||||.|:|.:|.:.
  Fly   368 SLGVVLFTCLSGTLPFSDEYGTPAAQQIKKGRFAYGHPSWKSVSQRAKLLINQMLIVDPERRPSI 432

  Fly   264 AEALKHPWI 272
            .:.|:..|:
  Fly   433 DDVLQSSWL 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKIINP_001162833.1 STKc_CaMKII 12..303 CDD:270988 99/269 (37%)
S_TKc 14..272 CDD:214567 98/267 (37%)
CaMKII_AD 390..517 CDD:285524
lokNP_477219.1 FHA 39..156 CDD:238017
STKc_Chk2 167..441 CDD:270986 98/267 (37%)
S_TKc 174..441 CDD:214567 98/267 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.