DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKII and CG17528

DIOPT Version :9

Sequence 1:NP_001162833.1 Gene:CaMKII / 43828 FlyBaseID:FBgn0264607 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_001036462.1 Gene:CG17528 / 3355134 FlyBaseID:FBgn0261387 Length:748 Species:Drosophila melanogaster


Alignment Length:264 Identity:99/264 - (37%)
Similarity:154/264 - (58%) Gaps:8/264 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 DNYDIKEELGKGAFSIVKRCVQKSTGFEFAAKIINTKKLTARDFQKLEREARICRKLHHPNIVRL 76
            :.|.:...:|.|.|:||.:...:.||..:|.|||:..|...:: ..::.|.|:.:||:||:|:.|
  Fly   475 NTYSLGRIIGDGNFAIVFKIKHRQTGHSYALKIIDKNKCKGKE-HYIDAEVRVMKKLNHPHIISL 538

  Fly    77 HDSIQEENYHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESVNHCHQNGVVHRDLKPEN 141
            ..|:.:....|||.:.|:||:||:.|.....:||..:...|:.:..::.:.|..|:||||:||||
  Fly   539 ILSVDQNTNMYLVLEYVSGGDLFDAITQVTRFSENQSRIMIRHLGAAMTYLHSMGIVHRDIKPEN 603

  Fly   142 LLLASKAKG--AAVKLADFGLAIEVQGDHQAWFGFAGTPGYLSPEVLKKEPYGKSVDIWACGVIL 204
            ||:.....|  ..:||||||||.||   :...:...|||.|::||:|.:..||..:|:||.|:||
  Fly   604 LLVKLDEHGNVLELKLADFGLACEV---NDLLYAVCGTPTYVAPEILLEVGYGLKIDVWAAGIIL 665

  Fly   205 YILLVGYPPFW--DEDQHRLYSQIKAGAYDYPSPEWDTVTPEAKNLINQMLTVNPNKRITAAEAL 267
            ||||.|:|||.  |..|..|:..|.:|.|::|.|.|..:....::||..||..:|:.|.|:.:.|
  Fly   666 YILLCGFPPFVAPDNQQEPLFDAIISGIYEFPDPYWSDIGDGVRDLIANMLQADPDVRFTSEDIL 730

  Fly   268 KHPW 271
            .|.|
  Fly   731 DHSW 734

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKIINP_001162833.1 STKc_CaMKII 12..303 CDD:270988 99/264 (38%)
S_TKc 14..272 CDD:214567 99/262 (38%)
CaMKII_AD 390..517 CDD:285524
CG17528NP_001036462.1 DCX 153..244 CDD:214711
DCX 308..396 CDD:214711
PKc_like 477..734 CDD:304357 98/260 (38%)
S_TKc 477..734 CDD:214567 98/260 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.