DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKII and PhKgamma

DIOPT Version :9

Sequence 1:NP_001162833.1 Gene:CaMKII / 43828 FlyBaseID:FBgn0264607 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_511129.3 Gene:PhKgamma / 32120 FlyBaseID:FBgn0011754 Length:560 Species:Drosophila melanogaster


Alignment Length:283 Identity:116/283 - (40%)
Similarity:162/283 - (57%) Gaps:18/283 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ACTRFSDNYDIKEELGKGAFSIVKRCVQKSTGFEFAAKIIN----TKKLTARDFQKLE---REAR 63
            |...|...|:.||.||:|..|.|:||::|.||.|||||||:    |:......:..||   :|..
  Fly    15 AAKGFYAKYEPKEILGRGISSTVRRCIEKETGKEFAAKIIDLGATTESGETNPYHMLEATRQEIS 79

  Fly    64 ICRK-LHHPNIVRLHDSIQEENYHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESVNHC 127
            |.|: :.||.|:.|.|..:.:.:.:|||:|...||||:.:.:....||......::||.|.|.:.
  Fly    80 ILRQVMGHPYIIDLQDVFESDAFVFLVFELCPKGELFDYLTSVVTLSEKKTRTIMRQIFEGVEYI 144

  Fly   128 HQNGVVHRDLKPENLLLASKAKGAAVKLADFGLAIEVQGDHQAWFGFAGTPGYLSPEVLK----- 187
            |...:|||||||||:||.....   ||:.|||.|.::| :.:......||||||:||.||     
  Fly   145 HAKSIVHRDLKPENILLDENHN---VKITDFGFAKQLQ-EGEKLTNLCGTPGYLAPETLKCNMFE 205

  Fly   188 -KEPYGKSVDIWACGVILYILLVGYPPFWDEDQHRLYSQIKAGAYDYPSPEWDTVTPEAKNLINQ 251
             ...|.:.|||||||||::.||||.||||...|..:...|..|.|.:.||||..::.:.|:||.:
  Fly   206 GSPGYSQEVDIWACGVIMFTLLVGCPPFWHRKQMVMLRNIMEGKYSFTSPEWADISEDPKDLIRK 270

  Fly   252 MLTVNPNKRITAAEALKHPWICQ 274
            .|.|:|::|||..|.|:||:..|
  Fly   271 CLVVDPSQRITVKEVLRHPFFNQ 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKIINP_001162833.1 STKc_CaMKII 12..303 CDD:270988 114/277 (41%)
S_TKc 14..272 CDD:214567 113/271 (42%)
CaMKII_AD 390..517 CDD:285524
PhKgammaNP_511129.3 STKc_PhKG 19..291 CDD:270995 114/275 (41%)
S_TKc 23..291 CDD:214567 113/271 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452304
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.