DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKII and Dclk3

DIOPT Version :9

Sequence 1:NP_001162833.1 Gene:CaMKII / 43828 FlyBaseID:FBgn0264607 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_001178729.1 Gene:Dclk3 / 316023 RGDID:1309232 Length:807 Species:Rattus norvegicus


Alignment Length:291 Identity:116/291 - (39%)
Similarity:177/291 - (60%) Gaps:8/291 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 NYDIKEELGKGAFSIVKRCVQKSTGFEFAAKIINTKKLTARDFQKLEREARICRKLHHPNIVRLH 77
            :|||...:|.|.|:|||.|..:.|...:|.|||:..:|..:: ..::.|..|.:.|.|||||:||
  Rat   514 HYDIGRVIGDGNFAIVKECKHRETRQAYAMKIIDKSQLKGKE-DIVDSEILIIQSLSHPNIVKLH 577

  Fly    78 DSIQEENYHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESVNHCHQNGVVHRDLKPENL 142
            :..:.|...||:.:.|.||:||:.|:....:.|.||:..|..:.:::.|.|...:||||||||||
  Rat   578 EVYETEAEIYLIMEYVQGGDLFDAIIESVKFPEPDAAVMITDLCKALVHMHDKKIVHRDLKPENL 642

  Fly   143 LL-ASKAKGAAVKLADFGLAIEVQGDHQAWFGFAGTPGYLSPEVLKKEPYGKSVDIWACGVILYI 206
            |: .::.|...:||||||||..|.   :..|...|||.|::||:|.::.||..||:||.||||||
  Rat   643 LVQRNEDKSTTLKLADFGLAKHVV---RPIFTVCGTPTYVAPEILSEKGYGLEVDMWAAGVILYI 704

  Fly   207 LLVGYPPFW--DEDQHRLYSQIKAGAYDYPSPEWDTVTPEAKNLINQMLTVNPNKRITAAEALKH 269
            ||.|:|||.  :.||..|::.|:.|.:::.||.||.::..||:|:..:|.|:|.||.||.:.|.|
  Rat   705 LLCGFPPFRSPERDQDELFNIIQLGQFEFLSPYWDNISDAAKDLVRNLLVVDPKKRYTAHQVLHH 769

  Fly   270 PWICQRERVASV-VHRQETVDCLKKFNARRK 299
            |||......::| ..::|:.....:|.::.|
  Rat   770 PWIGMVGHPSTVNPQKEESPSSEGRFQSQHK 800

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKIINP_001162833.1 STKc_CaMKII 12..303 CDD:270988 116/291 (40%)
S_TKc 14..272 CDD:214567 110/260 (42%)
CaMKII_AD 390..517 CDD:285524
Dclk3NP_001178729.1 UBQ 92..177 CDD:294102
PKc_like 514..771 CDD:304357 109/260 (42%)
S_TKc 515..772 CDD:214567 110/260 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.