DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKII and Camk1d

DIOPT Version :9

Sequence 1:NP_001162833.1 Gene:CaMKII / 43828 FlyBaseID:FBgn0264607 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_001100835.1 Gene:Camk1d / 307124 RGDID:1560691 Length:385 Species:Rattus norvegicus


Alignment Length:344 Identity:135/344 - (39%)
Similarity:202/344 - (58%) Gaps:14/344 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 YDIKEELGKGAFSIVKRCVQKSTGFEFAAKIINTKKLTARDFQKLEREARICRKLHHPNIVRLHD 78
            ::.||.||.||||.|....:|:||..||.|.|..|.|..:: ..:|.|..:.||:.|.|||.|.|
  Rat    23 FEFKETLGTGAFSEVVLAEEKATGKLFAVKCIPKKALKGKE-SSIENEIAVLRKIKHENIVALED 86

  Fly    79 SIQEENYHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESVNHCHQNGVVHRDLKPENLL 143
            ..:..|:.|||..||:|||||:.||.:.||:|.|||..|:|:|::|.:.|:.|:|||||||||||
  Rat    87 IYESPNHLYLVMQLVSGGELFDRIVEKGFYTEKDASTLIRQVLDAVYYLHRMGIVHRDLKPENLL 151

  Fly   144 LASKAKGAAVKLADFGLAIEVQGDHQAWFGFAGTPGYLSPEVLKKEPYGKSVDIWACGVILYILL 208
            ..|:.:.:.:.::||||: :::|.........|||||::||||.::||.|:||.|:.|||.||||
  Rat   152 YYSQDEESKIMISDFGLS-KMEGKGDVMSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVIAYILL 215

  Fly   209 VGYPPFWDEDQHRLYSQIKAGAYDYPSPEWDTVTPEAKNLINQMLTVNPNKRITAAEALKHPWIC 273
            .|||||:||:..:|:.||....|::.||.||.::..||:.|..::..:||||.|..:|.:||||.
  Rat   216 CGYPPFYDENDSKLFEQILKAEYEFDSPYWDDISDSAKDFIRNLMEKDPNKRYTCEQAARHPWIA 280

  Fly   274 QRERVASVVHRQETVDCLKKFNARRKLKGAILTTMLATRNFSSRSMITKKGEGSQVKESTDSSST 338
            ....::..:|...:....|.| |:.|.:.|...|           .:.:.....|:..|.|||:.
  Rat   281 GDTALSKNIHESVSAQIRKNF-AKSKWRQAFNAT-----------AVVRHMRRLQLGSSLDSSNA 333

  Fly   339 TLEDDDIKEDKKGTVDRST 357
            ::..:.....:|..:..||
  Rat   334 SVSSNLSLASQKDCLAPST 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKIINP_001162833.1 STKc_CaMKII 12..303 CDD:270988 125/288 (43%)
S_TKc 14..272 CDD:214567 118/257 (46%)
CaMKII_AD 390..517 CDD:285524
Camk1dNP_001100835.1 STKc_CaMKI_delta 12..312 CDD:271070 126/291 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X46
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.