DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKII and cmk1

DIOPT Version :9

Sequence 1:NP_001162833.1 Gene:CaMKII / 43828 FlyBaseID:FBgn0264607 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_593464.1 Gene:cmk1 / 2542442 PomBaseID:SPACUNK12.02c Length:335 Species:Schizosaccharomyces pombe


Alignment Length:319 Identity:121/319 - (37%)
Similarity:176/319 - (55%) Gaps:24/319 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 YDIKEELGKGAFSIVKRCVQKSTGFEFAAKIINTKKLTAR-DFQKLEREARICRKL--HHPNIVR 75
            |.:...||.|.::.|:..|...|...:||||:|.|.:..: ||.|  .|..|.:::  .||||:.
pombe    31 YRVGRVLGGGTYATVREAVHIETNKMYAAKIMNKKMMEKKQDFVK--NEIAILKRVSYEHPNILH 93

  Fly    76 LHDSIQEENYHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESVNHCHQNGVVHRDLKPE 140
            |.|..:..|..||:.:|.||||||:.|.|:..:.||||:..::....:|.:.|.||:||||||||
pombe    94 LVDFFETVNNLYLITELATGGELFDRICAKGSFYEADAAALMRTTTSAVKYLHDNGIVHRDLKPE 158

  Fly   141 NLLLASKAKGAAVKLADFGLAIEVQGDHQAW--FGFAGTPGYLSPEVLKKEPYGKSVDIWACGVI 203
            |||..||...:.:.:|||||: ....|.|.:  ....|||.|::|||.::..|||.||:||.|||
pombe   159 NLLYRSKDPNSDLLIADFGLS-HFYEDSQYYMLMTACGTPEYMAPEVFRRTGYGKPVDMWAIGVI 222

  Fly   204 LYILLVGYPPFWDEDQHRLYSQIKAGAYDYPSPEWDTVTPEAKNLINQMLTVNPNKRITAAEALK 268
            .|.||.||.||....|..:...|.|..|.:..|.|..::..||:.|.:.|..:|:||:|||:|||
pombe   223 TYFLLSGYTPFARPSQVEVIEAILANEYTFNDPCWSGISETAKDFIKKCLENDPSKRLTAADALK 287

  Fly   269 HPWICQRERVASVVHRQETVDCL----KKFNARRKLKGAILTTMLATRNFSSRSMITKK 323
            ||::.::        |..|.:.|    :.||||:..:    |...|.|.|::...:..|
pombe   288 HPFLSEK--------RPATSNLLPNVRENFNARKTFR----TAYNAVRAFNTWKKLENK 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKIINP_001162833.1 STKc_CaMKII 12..303 CDD:270988 116/297 (39%)
S_TKc 14..272 CDD:214567 109/262 (42%)
CaMKII_AD 390..517 CDD:285524
cmk1NP_593464.1 STKc_CAMK 30..290 CDD:270687 108/261 (41%)
S_TKc 31..291 CDD:214567 109/262 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X46
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.