DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKII and Dclk3

DIOPT Version :9

Sequence 1:NP_001162833.1 Gene:CaMKII / 43828 FlyBaseID:FBgn0264607 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_766516.2 Gene:Dclk3 / 245038 MGIID:3039580 Length:790 Species:Mus musculus


Alignment Length:263 Identity:109/263 - (41%)
Similarity:165/263 - (62%) Gaps:7/263 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 NYDIKEELGKGAFSIVKRCVQKSTGFEFAAKIINTKKLTARDFQKLEREARICRKLHHPNIVRLH 77
            :|||...:|.|.|:.||.|..:.|...:|.|:|:..:|..:: ..::.|..|.:.|.|||||:||
Mouse   513 HYDIGGVIGDGNFATVKECRHRETKQAYAMKMIDKSQLKGKE-DIVDSEILIIQSLSHPNIVKLH 576

  Fly    78 DSIQEENYHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESVNHCHQNGVVHRDLKPENL 142
            :..:.|...||:.:.|.||:||:.||....:.|.:|:..|..:.:::.|.|...:||||:|||||
Mouse   577 EVYETEAEIYLIMEYVQGGDLFDAIVENVKFPEPEAAVMITDLCKALVHMHDKNIVHRDVKPENL 641

  Fly   143 LL-ASKAKGAAVKLADFGLAIEVQGDHQAWFGFAGTPGYLSPEVLKKEPYGKSVDIWACGVILYI 206
            |: .::.|...:||||||||..|.   :..|...|||.|::||:|.::.||..||:||.||||||
Mouse   642 LVQRNEDKSITLKLADFGLAKYVV---RPIFTVCGTPTYVAPEILSEKGYGLEVDMWAAGVILYI 703

  Fly   207 LLVGYPPFW--DEDQHRLYSQIKAGAYDYPSPEWDTVTPEAKNLINQMLTVNPNKRITAAEALKH 269
            ||.|:|||.  :.||..|::.|:.|.:::.||.||.::..||:|:..:|.|:|.||.||.:.|:|
Mouse   704 LLCGFPPFRSPERDQDELFNIIQVGQFEFLSPYWDNISDAAKDLVRNLLEVDPKKRYTAEQVLQH 768

  Fly   270 PWI 272
            |||
Mouse   769 PWI 771

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKIINP_001162833.1 STKc_CaMKII 12..303 CDD:270988 109/263 (41%)
S_TKc 14..272 CDD:214567 107/260 (41%)
CaMKII_AD 390..517 CDD:285524
Dclk3NP_766516.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..37
UBQ 92..177 CDD:294102
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..290
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 315..506
PKc_like 513..770 CDD:304357 106/260 (41%)
S_TKc 514..771 CDD:214567 107/260 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.