DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKII and zyg-8

DIOPT Version :9

Sequence 1:NP_001162833.1 Gene:CaMKII / 43828 FlyBaseID:FBgn0264607 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_499571.2 Gene:zyg-8 / 176639 WormBaseID:WBGene00006993 Length:802 Species:Caenorhabditis elegans


Alignment Length:268 Identity:99/268 - (36%)
Similarity:149/268 - (55%) Gaps:11/268 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 DNYDIKEELGKGAFSIVKRCVQKSTGFE-FAAKIINTKKLTARDFQKLEREARICRKLHHPNIVR 75
            :.:.:...:|.|..::|...:.|:...: .|.|:|..:.:..:: ..:|.|..|.:|:.|..||:
 Worm   480 EKFQLVRLIGDGNTAVVYEVIDKTNNDDRKAMKVIARENVIGKE-HLIEMELAILQKIDHTFIVQ 543

  Fly    76 LHDSIQEENYHYLVFDLVTGGELFEDIVAREFYSEADASH---CIQQILESVNHCHQNGVVHRDL 137
            |:|....::.:||..:|:..|:|||.:.......|.||..   |:.|.||   :.|:.|:||||:
 Worm   544 LYDHWFVDDSYYLSLELIEMGDLFEHLRIVRRVPERDAVRMMTCLGQALE---YIHELGIVHRDV 605

  Fly   138 KPENLLLASKAKG-AAVKLADFGLAIEVQGDHQAWFGFAGTPGYLSPEVLKKEPYGKSVDIWACG 201
            |.||||:.....| ..|||||||||.|:..|........|||.|::||||.|..||..|||||.|
 Worm   606 KLENLLIVKDEFGELGVKLADFGLAAEMPKDFGVLSTICGTPTYVAPEVLNKTGYGCKVDIWAAG 670

  Fly   202 VILYILLVGYPPFWDED--QHRLYSQIKAGAYDYPSPEWDTVTPEAKNLINQMLTVNPNKRITAA 264
            ||||.:|||:|||...|  :..|:|.|.:|.:.:|||.||.|:...::||..::..:|..|.:|.
 Worm   671 VILYAILVGFPPFQSSDGSEQDLFSAIMSGEFSFPSPSWDDVSWSVRHLIMCLIHTDPFHRYSAG 735

  Fly   265 EALKHPWI 272
            |.|...|:
 Worm   736 ELLNDEWM 743

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKIINP_001162833.1 STKc_CaMKII 12..303 CDD:270988 99/268 (37%)
S_TKc 14..272 CDD:214567 98/264 (37%)
CaMKII_AD 390..517 CDD:285524
zyg-8NP_499571.2 DCX 206..298 CDD:214711
DCX 335..423 CDD:214711
STKc_DCKL 481..742 CDD:270997 98/264 (37%)
S_TKc 482..743 CDD:214567 98/264 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.