DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKII and Camk1

DIOPT Version :9

Sequence 1:NP_001162833.1 Gene:CaMKII / 43828 FlyBaseID:FBgn0264607 Length:531 Species:Drosophila melanogaster
Sequence 2:XP_006237061.1 Gene:Camk1 / 171503 RGDID:629473 Length:414 Species:Rattus norvegicus


Alignment Length:315 Identity:127/315 - (40%)
Similarity:186/315 - (59%) Gaps:3/315 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 DNYDIKEELGKGAFSIVKRCVQKSTGFEFAAKIINTKKLTARDFQKLEREARICRKLHHPNIVRL 76
            |.||.::.||.||||.|.....|.|....|.|.|..|.|..:: ..:|.|..:..|:.|||||.|
  Rat    49 DIYDFRDVLGTGAFSEVILAEDKRTQKLVAIKCIAKKALEGKE-GSMENEIAVLHKIKHPNIVAL 112

  Fly    77 HDSIQEENYHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESVNHCHQNGVVHRDLKPEN 141
            .|..:...:.||:..||:|||||:.||.:.||:|.|||..|.|:|::|.:.|..|:|||||||||
  Rat   113 DDIYESGGHLYLIMQLVSGGELFDRIVEKGFYTERDASRLIFQVLDAVKYLHDLGIVHRDLKPEN 177

  Fly   142 LLLASKAKGAAVKLADFGLAIEVQGDHQAWFGFAGTPGYLSPEVLKKEPYGKSVDIWACGVILYI 206
            ||..|..:.:.:.::||||: :::..........|||||::||||.::||.|:||.|:.|||.||
  Rat   178 LLYYSLDEDSKIMISDFGLS-KMEDPGSVLSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVIAYI 241

  Fly   207 LLVGYPPFWDEDQHRLYSQIKAGAYDYPSPEWDTVTPEAKNLINQMLTVNPNKRITAAEALKHPW 271
            ||.|||||:||:..:|:.||....|::.||.||.::..||:.|..::..:|.||.|..:||:|||
  Rat   242 LLCGYPPFYDENDAKLFEQILKAEYEFDSPYWDDISDSAKDFIRHLMEKDPEKRFTCEQALQHPW 306

  Fly   272 ICQRERVASVVHRQETVDCLKKFNARRKLKGAILTTMLATRNFSSRSMITKKGEG 326
            |.....:...:| |...:.:||..|:.|.|.|...|.:.......:...:::|:|
  Rat   307 IAGDTALDKNIH-QSVSEQIKKNFAKSKWKQAFNATAVVRHMRKLQLGTSQEGQG 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKIINP_001162833.1 STKc_CaMKII 12..303 CDD:270988 123/290 (42%)
S_TKc 14..272 CDD:214567 113/257 (44%)
CaMKII_AD 390..517 CDD:285524
Camk1XP_006237061.1 STKc_CaMKI_alpha 47..309 CDD:271069 116/261 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X46
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.