DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKII and DCLK2

DIOPT Version :9

Sequence 1:NP_001162833.1 Gene:CaMKII / 43828 FlyBaseID:FBgn0264607 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_001035351.4 Gene:DCLK2 / 166614 HGNCID:19002 Length:783 Species:Homo sapiens


Alignment Length:341 Identity:126/341 - (36%)
Similarity:189/341 - (55%) Gaps:14/341 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CTRFS---DNYDIKEELGKGAFSIVKRCVQKSTGFEFAAKIINTKKLTARDFQKLEREARICRKL 68
            |:..|   :.|.|.:.:|.|.|::||.|:.:|||.|||.|||:..|...:: ..:|.|..|.|::
Human   401 CSESSTLLEKYKIGKVIGDGNFAVVKECIDRSTGKEFALKIIDKAKCCGKE-HLIENEVSILRRV 464

  Fly    69 HHPNIVRLHDSIQEENYHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESVNHCHQNGVV 133
            .||||:.|.:.::.....:||.:||.||:||:.|.:...|:|.|.|..:..:..::.:.|...:|
Human   465 KHPNIIMLVEEMETATELFLVMELVKGGDLFDAITSSTKYTERDGSAMVYNLANALRYLHGLSIV 529

  Fly   134 HRDLKPENLLLASKAKGA-AVKLADFGLAIEVQGDHQAWFGFAGTPGYLSPEVLKKEPYGKSVDI 197
            |||:||||||:.....|. ::||.|||||..|:|   ..:...|||.|::||::.:..||..|||
Human   530 HRDIKPENLLVCEYPDGTKSLKLGDFGLATVVEG---PLYTVCGTPTYVAPEIIAETGYGLKVDI 591

  Fly   198 WACGVILYILLVGYPPFWDED--QHRLYSQIKAGAYDYPSPEWDTVTPEAKNLINQMLTVNPNKR 260
            ||.|||.||||.|:|||..|:  |..|:.||.||..::|:|.||.:|..||.||:|||.||...|
Human   592 WAAGVITYILLCGFPPFRSENNLQEDLFDQILAGKLEFPAPYWDNITDSAKELISQMLQVNVEAR 656

  Fly   261 ITAAEALKHPWICQRERVASVVHRQETVDCLKKFNARRKLKGAILTTMLATRNFSSRSMITKKGE 325
            .||.:.|.|||:.......:.:..:.|....:.||.....:.:..|.:....|    :.:.|:|:
Human   657 CTAGQILSHPWVSDDASQENNMQAEVTGKLKQHFNNALPKQNSTTTGVSVIMN----TALDKEGQ 717

  Fly   326 GSQVKESTDSSSTTLE 341
            ....|...||....:|
Human   718 IFCSKHCQDSGRPGME 733

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKIINP_001162833.1 STKc_CaMKII 12..303 CDD:270988 116/293 (40%)
S_TKc 14..272 CDD:214567 112/260 (43%)
CaMKII_AD 390..517 CDD:285524
DCLK2NP_001035351.4 DCX 67..157 CDD:214711
DCX 192..280 CDD:214711
STKc_DCKL2 409..667 CDD:271086 111/261 (43%)
S_TKc 411..668 CDD:214567 112/260 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.