DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKII and DCX

DIOPT Version :9

Sequence 1:NP_001162833.1 Gene:CaMKII / 43828 FlyBaseID:FBgn0264607 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_000546.2 Gene:DCX / 1641 HGNCID:2714 Length:441 Species:Homo sapiens


Alignment Length:318 Identity:54/318 - (16%)
Similarity:114/318 - (35%) Gaps:79/318 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 DASHCIQQILESVNHCHQNGVV------HRDLKPENLLLASKAKGAAVKLADFGLAIEVQGDHQA 170
            |.|||     :|:.. |||..:      .||....|:      :|:.:.    ||.......|.:
Human    69 DRSHC-----QSLRF-HQNMELDFGHFDERDKTSRNM------RGSRMN----GLPSPTHSAHCS 117

  Fly   171 WFGFAGTPGYLSPEVLKKEPYGKSVDIWACGVILYILLVGYPPFWDEDQHRLYSQIKAGAYDYPS 235
            ::.........:.:..||..:.::.|.:..|::..:         ..|:.|.:..:.|   |...
Human   118 FYRTRTLQALSNEKKAKKVRFYRNGDRYFKGIVYAV---------SSDRFRSFDALLA---DLTR 170

  Fly   236 PEWDTVT-PEAKNLINQMLTVNPNKRITAAEALK--HPWICQRERVASVVHRQETVDCLKKFNAR 297
            ...|.:. |:.   :..:.|::.:::|.:.:.|:  ..::|..:...      :.|:..|..|..
Human   171 SLSDNINLPQG---VRYIYTIDGSRKIGSMDELEEGESYVCSSDNFF------KKVEYTKNVNPN 226

  Fly   298 RKLKGAILTTMLATRNFSSRSMITKKGEGSQVKESTDSSSTTLEDDDIKEDKKGTVDRSTTVVSK 362
            ..:.......|.|.::.:|                 .:|:...|:.|....|..|:.||..   |
Human   227 WSVNVKTSANMKAPQSLAS-----------------SNSAQARENKDFVRPKLVTIIRSGV---K 271

  Fly   363 EPEDIRILCPAKT---YQQNIGNSQCSSAARRQEIIKITEQLIEAINSGDFDGYTKIC 417
            ..:.:|:|...||   ::|.:.:.        .|.||:...:::.:.:  .||....|
Human   272 PRKAVRVLLNKKTAHSFEQVLTDI--------TEAIKLETGVVKKLYT--LDGKQVTC 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKIINP_001162833.1 STKc_CaMKII 12..303 CDD:270988 32/199 (16%)
S_TKc 14..272 CDD:214567 28/168 (17%)
CaMKII_AD 390..517 CDD:285524 6/28 (21%)
DCXNP_000546.2 DCX 129..219 CDD:214711 15/110 (14%)
DCX 256..344 CDD:214711 17/77 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.