DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKII and Dcx

DIOPT Version :9

Sequence 1:NP_001162833.1 Gene:CaMKII / 43828 FlyBaseID:FBgn0264607 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_001103692.1 Gene:Dcx / 13193 MGIID:1277171 Length:366 Species:Mus musculus


Alignment Length:237 Identity:39/237 - (16%)
Similarity:87/237 - (36%) Gaps:57/237 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 KKEPYGKSVDIWACGVILYILLVGYPPFWDEDQHRLYSQIKAGAYDYPSPEWDTVT-PEAKNLIN 250
            ||..:.::.|.:..|::..:         ..|:.|.:..:.|   |......|.:. |:.   :.
Mouse    53 KKVRFYRNGDRYFKGIVYAV---------SSDRFRSFDALLA---DLTRSLSDNINLPQG---VR 102

  Fly   251 QMLTVNPNKRITAAEALK--HPWICQRERVASVVHRQETVDCLKKFNARRKLKGAILTTMLATRN 313
            .:.|::.:::|.:.:.|:  ..::|..:...      :.|:..|..|....:.......|.|.::
Mouse   103 YIYTIDGSRKIGSMDELEEGESYVCSSDNFF------KKVEYTKNVNPNWSVNVKTSANMKAPQS 161

  Fly   314 FSSRSMITKKGEGSQVKESTDSSSTTLEDDDIKEDKKGTVDRSTTVVSKEPEDIRILCPAKT--- 375
            .:|                 .:|:...|:.|....|..|:.||..   |..:.:|:|...||   
Mouse   162 LAS-----------------SNSAQARENKDFVRPKLVTIIRSGV---KPRKAVRVLLNKKTAHS 206

  Fly   376 YQQNIGNSQCSSAARRQEIIKITEQLIEAINSGDFDGYTKIC 417
            ::|.:.:.        .|.||:...:::.:.:  .||....|
Mouse   207 FEQVLTDI--------TEAIKLETGVVKKLYT--LDGKQVTC 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKIINP_001162833.1 STKc_CaMKII 12..303 CDD:270988 17/118 (14%)
S_TKc 14..272 CDD:214567 13/87 (15%)
CaMKII_AD 390..517 CDD:285524 6/28 (21%)
DcxNP_001103692.1 DCX1_DCX 51..139 CDD:340529 15/106 (14%)
DCX2 176..259 CDD:340589 16/76 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 275..366
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.