DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKII and Stk33

DIOPT Version :9

Sequence 1:NP_001162833.1 Gene:CaMKII / 43828 FlyBaseID:FBgn0264607 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_473444.1 Gene:Stk33 / 117229 MGIID:2152419 Length:491 Species:Mus musculus


Alignment Length:394 Identity:114/394 - (28%)
Similarity:182/394 - (46%) Gaps:56/394 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 RFSDNYDIKE------ELGKGAFSIVKRCVQKSTGFEFAAKIINTKKLTARDFQKLEREARICRK 67
            |..|...|:|      .||:|:|.:|...:.|.||.::|.|.:|.:|..:...:.||||..|.:.
Mouse   100 RMDDGAGIEEFYTFGRILGQGSFGMVFEAIDKETGAKWAIKKVNKEKAGSSAMKLLEREVSILKT 164

  Fly    68 LHHPNIVRLHDSIQEENYHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESVNHCHQNGV 132
            ::|.:|:.|....:.....|||.:|...|||...:..|..:||.:....||.:..::.:.|...:
Mouse   165 VNHQHIIHLEQVFESPQKMYLVMELCEDGELKAVMDQRGHFSENETRLIIQSLASAIAYLHNKDI 229

  Fly   133 VHRDLKPENLLLAS------KAKGAAVKLADFGLAIEVQGDHQAWFGF----AGTPGYLSPEVLK 187
            ||||||.||:::.|      ......:|:.||||:::..|....  |.    .|||.|::|||:.
Mouse   230 VHRDLKLENIMVKSSFIDDNNEMNLNIKVTDFGLSVQKHGSRSE--GMMQTTCGTPIYMAPEVIN 292

  Fly   188 KEPYGKSVDIWACGVILYILLVGYPPFWDEDQHRLYSQIKAGAYDYPSPEWDTVTPEAKNLINQM 252
            ...|.:..|||:.|||::|||.|.|||....:.:||..||.|...:.:|.|::|:..|||.:.|:
Mouse   293 AHDYSQQCDIWSIGVIMFILLCGEPPFLANSEEKLYELIKKGELRFENPVWESVSDSAKNTLKQL 357

  Fly   253 LTVNPNKRITAAEALKHPWI-------------------------------CQRERVASVVHRQE 286
            :.|:|..||||.|.|.:.|:                               ...|...|.|:...
Mouse   358 MKVDPAHRITAKELLDNQWLTGNTLSSARPTNVLEMMKEWKNNPESDEETNTDEETEQSAVYSPS 422

  Fly   287 TVDCLKKFNARRKLKGAILTTMLATRNFSSRSMIT--KKGEGSQVKESTDSSS---TTLEDDDIK 346
            .....:..||.:  |.|..:..:.:.|.||..:::  .|.|..:..|:...:|   |||:...:.
Mouse   423 ANTAKQPTNAAK--KPAAESVGMTSSNSSSSKLLSAESKAEPEKSSETVGHASVAKTTLKSTTLF 485

  Fly   347 EDKK 350
            ..||
Mouse   486 RGKK 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKIINP_001162833.1 STKc_CaMKII 12..303 CDD:270988 100/337 (30%)
S_TKc 14..272 CDD:214567 92/273 (34%)
CaMKII_AD 390..517 CDD:285524
Stk33NP_473444.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 51..89
PKc_like 109..377 CDD:419665 91/269 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 398..491 19/94 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.