DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKII and LOC100537554

DIOPT Version :9

Sequence 1:NP_001162833.1 Gene:CaMKII / 43828 FlyBaseID:FBgn0264607 Length:531 Species:Drosophila melanogaster
Sequence 2:XP_009295466.2 Gene:LOC100537554 / 100537554 -ID:- Length:311 Species:Danio rerio


Alignment Length:237 Identity:99/237 - (41%)
Similarity:143/237 - (60%) Gaps:7/237 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 EFAAKIINTKKLTARDFQKLEREARICRKLHHPNIVRLHDSIQEENYHYLVFDLVTGGELFEDIV 103
            |:|.|||:..|.:.:: ..:..|..|.|::.||:|:.|.:.:......|||.:||.||:||:.|.
Zfish    37 EYALKIIDKAKCSGKE-HLIANEVSILRRVRHPSIIMLIEELDTPTELYLVMELVKGGDLFDAIT 100

  Fly   104 AREFYSEADASHCIQQILESVNHCHQNGVVHRDLKPENLLLASKAKGA-AVKLADFGLAIEVQGD 167
            ....|:|.|||..:..:..::.:.|:..:||||:||||||:.....|. ::||.|||||..|:| 
Zfish   101 CSTKYTERDASAMLFNLTGALRYLHRMNIVHRDIKPENLLVCEYPDGTKSLKLGDFGLATVVEG- 164

  Fly   168 HQAWFGFAGTPGYLSPEVLKKEPYGKSVDIWACGVILYILLVGYPPFWDE--DQHRLYSQIKAGA 230
              ..:...|||.|::||::.:..||..|||||.|||.||||.|:|||..|  .|..|:.||..|.
Zfish   165 --PLYTVCGTPTYVAPEIIAESGYGLKVDIWAAGVITYILLCGFPPFRSEKNQQEELFEQILLGK 227

  Fly   231 YDYPSPEWDTVTPEAKNLINQMLTVNPNKRITAAEALKHPWI 272
            .|:|||.||.::..||:||.:||.|:...|.||.|.|:|.|:
Zfish   228 LDFPSPYWDNISDSAKDLIGKMLQVDVGDRYTADEVLEHCWV 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKIINP_001162833.1 STKc_CaMKII 12..303 CDD:270988 99/237 (42%)
S_TKc 14..272 CDD:214567 98/235 (42%)
CaMKII_AD 390..517 CDD:285524
LOC100537554XP_009295466.2 STKc_DCKL 35..268 CDD:270997 98/234 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.