DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKII and si:ch73-60h1.1

DIOPT Version :9

Sequence 1:NP_001162833.1 Gene:CaMKII / 43828 FlyBaseID:FBgn0264607 Length:531 Species:Drosophila melanogaster
Sequence 2:XP_002663771.2 Gene:si:ch73-60h1.1 / 100332381 ZFINID:ZDB-GENE-140106-152 Length:438 Species:Danio rerio


Alignment Length:366 Identity:151/366 - (41%)
Similarity:221/366 - (60%) Gaps:22/366 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 DNYDIKEELGKGAFSIVKRCVQKSTGFEFAAKIINTKKLTARDFQKLEREARICRKLHHPNIVRL 76
            |.|::..|||:||.|:|.||.:|.|...:|.|::  ||..  |.:.:..|..:..:|.||||:||
Zfish    26 DFYNMGPELGRGATSVVLRCEEKQTEKPYAVKVL--KKTI--DKKIVRTEIGVLLRLSHPNIIRL 86

  Fly    77 HDSIQEENYHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESVNHCHQNGVVHRDLKPEN 141
            .:..:.|...:|:.:||||||||:.||.|.:|||.||:|.|:||||:|.:.|:||||||||||||
Zfish    87 KEIFETETEIFLILELVTGGELFDRIVERGYYSERDAAHVIKQILEAVAYLHENGVVHRDLKPEN 151

  Fly   142 LLLASKAKGAAVKLADFGLAIEVQGDHQAWFGFAGTPGYLSPEVLKKEPYGKSVDIWACGVILYI 206
            ||.|..:..|.:|:|||||: ::..:........|||||.:||:|:...||..||:|:.||||||
Zfish   152 LLYADLSIDAPLKIADFGLS-KIIDEQVTMKTVCGTPGYCAPEILRGNAYGPEVDMWSVGVILYI 215

  Fly   207 LLVGYPPFWDE--DQHRLYSQIKAGAYDYPSPEWDTVTPEAKNLINQMLTVNPNKRITAAEALKH 269
            ||.|:.||:|:  ||: :||:|....|::.||.||.|:..||:|:|:::.::|:||:|..:||:|
Zfish   216 LLCGFEPFFDQRGDQY-MYSRILNCDYEFVSPWWDEVSLNAKDLVNKLIVLDPHKRLTVKQALEH 279

  Fly   270 PWICQRERVASVVHRQETVDCLKKFNARRKLKGAILTTMLATRNFSSRSMITKKGE--------- 325
            ||:.  .:.|...|...|...|::||||||||.|:...:..:|........|...|         
Zfish   280 PWVL--GKAARFSHMDTTQRKLQEFNARRKLKAAMKAVVATSRMHEGSRRRTDSCEMPNTDKTSC 342

  Fly   326 -GSQVKESTDSSSTTLEDDDIKEDKKGTVDRSTTVVSKEPE 365
             .|..||:|.:||.  |...:||..:...|.:....|..|:
Zfish   343 QSSIQKENTTNSSR--EPISMKEGSEQVADGALGPSSSTPQ 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKIINP_001162833.1 STKc_CaMKII 12..303 CDD:270988 135/292 (46%)
S_TKc 14..272 CDD:214567 121/259 (47%)
CaMKII_AD 390..517 CDD:285524
si:ch73-60h1.1XP_002663771.2 STKc_CaMKIV 24..317 CDD:270987 136/298 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100515
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X46
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.