DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKII and XB22062963

DIOPT Version :9

Sequence 1:NP_001162833.1 Gene:CaMKII / 43828 FlyBaseID:FBgn0264607 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_001135626.1 Gene:XB22062963 / 100216185 XenbaseID:XB-GENE-22062964 Length:385 Species:Xenopus tropicalis


Alignment Length:383 Identity:121/383 - (31%)
Similarity:210/383 - (54%) Gaps:43/383 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 SDNYDIKEELGKGAFSIVKRCVQKSTGFEFAAKIINTKKLTARDFQKLEREAR----ICRKLHHP 71
            :|.|||.|.|....|..:  |:.:....:   ::...||...:|.:|:.|.|:    |.:.::||
 Frog    21 TDKYDIGELLCAKEFCEI--CLAREIPTD---RLFLCKKFLKKDGRKVRRAAKNEISILKLVNHP 80

  Fly    72 NIVRLHDSIQEENYHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESVNHCHQNGVVHRD 136
            ||::|.|:.:.:...|::.:|.|||::|:.|.|:.:|||.|||:.::|:||:|::.|...:|||:
 Frog    81 NILQLIDTFETKKEFYIIQELATGGDVFDWISAQGYYSERDASNVLRQLLEAVSYLHSLRIVHRN 145

  Fly   137 LKPENLLLASKAKGAAVKLADFGLAIEVQGDHQAWFGFAGTPGYLSPEVLKKEPYGKSVDIWACG 201
            ||.|||:..::...:.|.|.||.|:....|:...   ..|||.||:|||:.:..||:.||.||.|
 Frog   146 LKLENLMYYNQNNHSKVVLRDFYLSCFESGEITE---PCGTPEYLAPEVVSRHRYGRPVDCWAVG 207

  Fly   202 VILYILLVGYPPFWDEDQ--------HRLYSQIKAGAYDYPSPEWDTVTPEAKNLINQMLTVNPN 258
            |:::|||.|.|||:||::        .:::.:|.||.|::.||.||.::..||:|:::::.::..
 Frog   208 VVMFILLSGNPPFYDENEEENSESHNRKIFRKILAGEYEFDSPYWDVISASAKDLVSRLMEMDQE 272

  Fly   259 KRITAAEALKHPWICQRERVASVVHRQETVDC--LKKFNARRKLKGAILTTMLATRNFSSRSMIT 321
            :||||.:||.|.||  ....||..:.:|.| |  ::|..|:.|.:.||..|....|        .
 Frog   273 QRITAQDALAHTWI--SGNAASERNLKEGV-CAQIEKNFAKAKWRKAIRVTTFMQR--------L 326

  Fly   322 KKGEGSQVKESTDSSSTTLEDDDIKEDKKGTVDRSTTVVSKEP-------EDIRILCP 372
            :..||:::..:..||.:...:..:   ...:..|.....::||       |.::..||
 Frog   327 RAPEGARLPVTPRSSMSVSHEVTV---APASPSRHPPHCTEEPACGSDPTESLKAPCP 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKIINP_001162833.1 STKc_CaMKII 12..303 CDD:270988 107/304 (35%)
S_TKc 14..272 CDD:214567 96/269 (36%)
CaMKII_AD 390..517 CDD:285524
XB22062963NP_001135626.1 PKc_like 22..286 CDD:304357 97/271 (36%)
S_TKc 24..286 CDD:214567 96/269 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.