DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Actbeta and BMP15

DIOPT Version :9

Sequence 1:NP_651942.2 Gene:Actbeta / 43826 FlyBaseID:FBgn0024913 Length:946 Species:Drosophila melanogaster
Sequence 2:NP_005439.2 Gene:BMP15 / 9210 HGNCID:1068 Length:392 Species:Homo sapiens


Alignment Length:389 Identity:89/389 - (22%)
Similarity:136/389 - (34%) Gaps:145/389 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   651 GTQYRQYRILEFSAQNRRVPSQKLSIRSAQIH-------------IRIDKPHSLWIEKAKSLPEK 702
            |.|.|:.|:|..|.:.    ..:|..|||..|             :|:.||              
Human    54 GEQPRKPRLLGHSLRY----MLELYRRSADSHGHPRENRTIGATMVRLVKP-------------- 100

  Fly   703 HLLNTKRKWGANKPHH---RIKIWVFQLSTSINITEKGIDKAIIFRASFQVDPKNL--------- 755
             |.|..|      ||.   .|:|..|.|..:..:.:. :...:::|...|:...||         
Human   101 -LTNVAR------PHRGTWHIQILGFPLRPNRGLYQL-VRATVVYRHHLQLTRFNLSCHVEPWVQ 157

  Fly   756 ----------------------GWQKFDLTDTIRE-WYGHTSHEKLRLLIDC---TGCGGRYSLH 794
                                  .|::.|:|..::: ::.:..|..|||...|   ...||....|
Human   158 KNPTNHFPSSEGDSSKPSLMSNAWKEMDITQLVQQRFWNNKGHRILRLRFMCQQQKDSGGLELWH 222

  Fly   795 LFQTSKLRGNSSDYLSTNPNRPFLVLH---TESS----------------------RTRR----- 829
                    |.||..::      ||:|:   |..|                      |||:     
Human   223 --------GTSSLDIA------FLLLYFNDTHKSIRKAKFLPRGMEEFMERESLLRRTRQADGIS 273

  Fly   830 --VRRRAVDCGGALNGQCCKESFYVSFKALGWDDWIIAPRGYFANYCRGDCTGSFR----TPDTF 888
              |...:....|..|.||....|.:||:.||||.|||||..|..|||:|.|....|    :|:  
Human   274 AEVTASSSKHSGPENNQCSLHPFQISFRQLGWDHWIIAPPFYTPNYCKGTCLRVLRDGLNSPN-- 336

  Fly   889 QTFHAHFIEEYRKMGLMNGM------RPCCAPIKFSSMSLIYYGDDG-IIKRDLPKMVVDECGC 945
               ||..      ..|:|.:      ||.|.|.|:..:|::....:| |:.::...|:.:.|.|
Human   337 ---HAII------QNLINQLVDQSVPRPSCVPYKYVPISVLMIEANGSILYKEYEGMIAESCTC 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ActbetaNP_651942.2 TGFb_propeptide 370..>509 CDD:279078
TGF_beta 843..945 CDD:278448 36/112 (32%)
BMP15NP_005439.2 TGF_beta 291..391 CDD:306518 35/110 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.