DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Actbeta and INHBE

DIOPT Version :9

Sequence 1:NP_651942.2 Gene:Actbeta / 43826 FlyBaseID:FBgn0024913 Length:946 Species:Drosophila melanogaster
Sequence 2:NP_113667.1 Gene:INHBE / 83729 HGNCID:24029 Length:350 Species:Homo sapiens


Alignment Length:341 Identity:90/341 - (26%)
Similarity:122/341 - (35%) Gaps:112/341 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   639 GNTQEIITFAEEGTQYRQYRILEFSAQNRRVPSQKLSIRSAQIHIRIDKPHS-------LWIEKA 696
            ||.:|:|:||                    ..:...|..|:.:...:..|.|       ||:...
Human    87 GNGEEVISFA--------------------TVTDSTSAYSSLLTFHLSTPRSHHLYHARLWLHVL 131

  Fly   697 KSLPEKHLLNTKRKWGANK----------PHHRIKIWVFQLSTSINITEKGIDKAIIFRASFQVD 751
            .:||....|...| ||..:          .||              ||                 
Human   132 PTLPGTLCLRIFR-WGPRRRRQGSRTLLAEHH--------------IT----------------- 164

  Fly   752 PKNLGWQKFDLTDT-IREWYGHTSHEKLRLLIDCTGCGGRYSLHLFQTSKLRGNSSDYLSTNPNR 815
              ||||....|..: :|   |..| ..|:|.:||              ..|.|||:  ::..|.|
Human   165 --NLGWHTLTLPSSGLR---GEKS-GVLKLQLDC--------------RPLEGNST--VTGQPRR 207

  Fly   816 ---------PFLVLHTESSR--TRRVRRRAVDCGGALNGQCCKESFYVSFKALGWDDWIIAPRGY 869
                     |||.|...::.  ..|.|||...|..| ...||:...||.|:.|||.|||:.|.||
Human   208 LLDTAGHQQPFLELKIRANEPGAGRARRRTPTCEPA-TPLCCRRDHYVDFQELGWRDWILQPEGY 271

  Fly   870 FANYCRGDC----TGSFRTPDTFQTFHAHFIEEYRKMGLMNGMRPCCAPIKFSSMSLIYYGDDG- 929
            ..|||.|.|    .||   |....:||:......:..........||.|.....:||:|...:| 
Human   272 QLNYCSGQCPPHLAGS---PGIAASFHSAVFSLLKANNPWPASTSCCVPTARRPLSLLYLDHNGN 333

  Fly   930 IIKRDLPKMVVDECGC 945
            ::|.|:|.|||:.|||
Human   334 VVKTDVPDMVVEACGC 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ActbetaNP_651942.2 TGFb_propeptide 370..>509 CDD:279078
TGF_beta 843..945 CDD:278448 38/106 (36%)
INHBENP_113667.1 TGF_beta 247..349 CDD:306518 38/104 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 116 1.000 Domainoid score I5953
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1385831at2759
OrthoFinder 1 1.000 - - FOG0000887
OrthoInspector 1 1.000 - - otm40920
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11848
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X477
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.880

Return to query results.
Submit another query.