DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Actbeta and GDF5

DIOPT Version :9

Sequence 1:NP_651942.2 Gene:Actbeta / 43826 FlyBaseID:FBgn0024913 Length:946 Species:Drosophila melanogaster
Sequence 2:NP_000548.2 Gene:GDF5 / 8200 HGNCID:4220 Length:501 Species:Homo sapiens


Alignment Length:377 Identity:92/377 - (24%)
Similarity:141/377 - (37%) Gaps:95/377 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   600 GRSSIGYQPAIHN-IEYENQKGHHESFADDHENIDHEDFFGNTQEIITFAEEGTQYRQYRILEFS 663
            |.||:..:..:.| |.....||.     ||...:..:..:  ..:|....::|....:.|||...
Human   188 GNSSVKLEAGLANTITSFIDKGQ-----DDRGPVVRKQRY--VFDISALEKDGLLGAELRILRKK 245

  Fly   664 AQNRRVPSQKLSIRSAQIHIRIDKPHSLWIEKAKSLPEKH----LLNTKRKWGANKPHHRI-KIW 723
            ..:...|:.....|:||:             |..|.|...    ||:.:...|.:.....: .||
Human   246 PSDTAKPAAPGGGRAAQL-------------KLSSCPSGRQPAALLDVRSVPGLDGSGWEVFDIW 297

  Fly   724 VF--------QLSTSINITEKGIDKAIIFRASFQVDPKNLGWQKFDLTDTIREWYGHTSHEKLRL 780
            ..        ||...:...|:|       ||   ||.:.||:.:          .....|||...
Human   298 KLFRNFKNSAQLCLELEAWERG-------RA---VDLRGLGFDR----------AARQVHEKALF 342

  Fly   781 LIDCTGCGGRYSLH--LFQTSKLRGNSSD-----YLSTNPNRPFLVLHTESSRTRRVRRRAVDCG 838
            |:     .||....  .|...|.|....|     ||.:...:....|     .||:.:|.:.:  
Human   343 LV-----FGRTKKRDLFFNEIKARSGQDDKTVYEYLFSQRRKRRAPL-----ATRQGKRPSKN-- 395

  Fly   839 GALNGQCCKESFYVSFKALGWDDWIIAPRGYFANYCRGDCTGSFRT---PDTFQTFHAHFIEEYR 900
              |..:|.:::.:|:||.:|||||||||..|.|.:|.|.|....|:   |    |.||..     
Human   396 --LKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEP----TNHAVI----- 449

  Fly   901 KMGLMNGMRP------CCAPIKFSSMSLIYYGD-DGIIKRDLPKMVVDECGC 945
             ..|||.|.|      ||.|.:.|.:|:::... :.::.:....|||:.|||
Human   450 -QTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGC 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ActbetaNP_651942.2 TGFb_propeptide 370..>509 CDD:279078
TGF_beta 843..945 CDD:278448 37/111 (33%)
GDF5NP_000548.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 29..169
TGFb_propeptide 145..344 CDD:279078 39/195 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 246..265 4/31 (13%)
TGFB 400..501 CDD:214556 39/111 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.