DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Actbeta and ndr1

DIOPT Version :9

Sequence 1:NP_651942.2 Gene:Actbeta / 43826 FlyBaseID:FBgn0024913 Length:946 Species:Drosophila melanogaster
Sequence 2:NP_571041.1 Gene:ndr1 / 799352 ZFINID:ZDB-GENE-990415-256 Length:392 Species:Danio rerio


Alignment Length:371 Identity:80/371 - (21%)
Similarity:140/371 - (37%) Gaps:102/371 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   628 DHENIDHEDFFGNTQEIITFAEEGTQYRQYRILEFSAQNRRVPSQKLS-------------IRSA 679
            |.::..||:              .|.|....:|...|::......|.:             ::.|
Zfish    70 DEKHFSHEN--------------PTLYESDSVLSLVAKSCHQVGDKFAVTFDMSSISASDDVQRA 120

  Fly   680 QIHIRIDKPHSLWIEKAKSLPEKHLLNTKRKWGANKPHHRIKIWVFQLSTS-INITEKGIDKAII 743
            ::.||:  ||      .:|..|..:.:.........|...:::.:..|:.: ||.|         
Zfish   121 ELRIRL--PH------LRSELEVDIYHASTPECERSPCEEVRVHLGTLNANPINST--------- 168

  Fly   744 FRASFQVDPKNLGWQKFDLTDTIREWYGHTSHEKLRLLID-----CTGCGGRYSLH--------- 794
            ||:|         |:.|::|..::.|.    |:..|:..:     .....|..|:|         
Zfish   169 FRSS---------WRIFNITALLKYWL----HQSERVPFEEPTQMPPMAEGHKSVHHPTANRVMM 220

  Fly   795 LFQTSKLRGNSSDYLSTNPNRPFLVL-------------HTESSRT-RRVRRRAVDC-------G 838
            :..:.:.|..:|..:.|..:..::.|             |..:.|| .|||..|...       |
Zfish   221 VVYSKQNRAKTSTLIRTAEHSKYVALDRAGGGSEPVPRRHRRNHRTDDRVRDAAAGMIPGVSHEG 285

  Fly   839 GALNGQCCKESFYVSFKALGWDDWIIAPRGYFANYCRGDCTGSFRTP--DTFQTFHAHFIEEYRK 901
            |.....|.|...:|.|..:||.|||:.|:.|.|..|.|.|.    ||  :||...:..:::...|
Zfish   286 GEKKPLCKKVDMWVDFDQIGWSDWIVYPKRYNAYRCEGSCP----TPVDETFTPTNHAYMQSLLK 346

  Fly   902 MGLMNGMRPC--CAPIKFSSMSLIYYGDDGIIKRDLPKMVVDECGC 945
            :...:.: ||  |.|.:.:.:|::||.:..::.|....|||.||||
Zfish   347 LHHPDRV-PCLSCVPTRLAPLSMLYYENGKMVMRHHEGMVVAECGC 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ActbetaNP_651942.2 TGFb_propeptide 370..>509 CDD:279078
TGF_beta 843..945 CDD:278448 33/105 (31%)
ndr1NP_571041.1 TGFb_propeptide 56..190 CDD:279078 28/163 (17%)
TGF_beta 291..391 CDD:278448 33/104 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.