DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Actbeta and mstnb

DIOPT Version :9

Sequence 1:NP_651942.2 Gene:Actbeta / 43826 FlyBaseID:FBgn0024913 Length:946 Species:Drosophila melanogaster
Sequence 2:NP_571094.2 Gene:mstnb / 798441 ZFINID:ZDB-GENE-990415-165 Length:374 Species:Danio rerio


Alignment Length:347 Identity:85/347 - (24%)
Similarity:139/347 - (40%) Gaps:91/347 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   622 HESFADDHEN--IDHEDFFGNTQEIITFAEEGTQYRQYR------ILEFSAQ---NRRVPSQKLS 675
            ::...||.::  ::.:|....|:.|:|.|.|.....|..      ...||.:   ||.|.:|   
Zfish    95 YDVLGDDSKDGAVEEDDEHATTETIMTMATEPDPIVQVDRKPKCCFFSFSPKIQANRIVRAQ--- 156

  Fly   676 IRSAQIHIR-IDKPHSLWIEKAKSLPEKHLLNTKRKWGANKPHHRIKIWVFQLSTSINITEKGID 739
               ..:|:| .::..:::::.::.:|.|           :...|||:                  
Zfish   157 ---LWVHLRPAEEATTVFLQISRLMPVK-----------DGGRHRIR------------------ 189

  Fly   740 KAIIFRASFQVDPKNLG---WQKFDLTDTIREWYGHTSHEKLRLLIDCTGCGGRYSLHLFQTSKL 801
                   |.::| .|.|   ||..|:...:..|.....          |..|...:.:     ..
Zfish   190 -------SLKID-VNAGVTSWQSIDVKQVLTVWLKQPE----------TNRGIEINAY-----DA 231

  Fly   802 RGNSSDYLSTNPNR----PFLVLHTESSRTRRVRR-RAVDCG-GALNGQCCKESFYVSFKALGWD 860
            :||.....||....    ||:.:.. |...:|:|| ..:||. .:...:||:....|.|:..|| 
Zfish   232 KGNDLAVTSTETGEDGLLPFMEVKI-SEGPKRIRRDSGLDCDENSSESRCCRYPLTVDFEDFGW- 294

  Fly   861 DWIIAPRGYFANYCRGDCTGSFRTPDTFQTF-HAHFIEEYRKMGLMNGMRPCCAPIKFSSMSLIY 924
            ||||||:.|.||||.|:|...:     .|.: |.|.:.:....|...   |||.|.|.|.::::|
Zfish   295 DWIIAPKRYKANYCSGECDYMY-----LQKYPHTHLVNKASPRGTAG---PCCTPTKMSPINMLY 351

  Fly   925 Y-GDDGIIKRDLPKMVVDECGC 945
            : |.:.||...:|.||||.|||
Zfish   352 FNGKEQIIYGKIPSMVVDRCGC 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ActbetaNP_651942.2 TGFb_propeptide 370..>509 CDD:279078
TGF_beta 843..945 CDD:278448 39/103 (38%)
mstnbNP_571094.2 TGFb_propeptide 38..252 CDD:279078 37/214 (17%)
TGFB 280..374 CDD:214556 41/103 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.