DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Actbeta and TGFB3

DIOPT Version :9

Sequence 1:NP_651942.2 Gene:Actbeta / 43826 FlyBaseID:FBgn0024913 Length:946 Species:Drosophila melanogaster
Sequence 2:NP_001316868.1 Gene:TGFB3 / 7043 HGNCID:11769 Length:412 Species:Homo sapiens


Alignment Length:462 Identity:106/462 - (22%)
Similarity:164/462 - (35%) Gaps:126/462 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   530 LKSGAVRK--VNGINGTQMNENALKKSTYPIDINH------SIDNKTHTGKNGEMSHNDYEYFND 586
            |..|.::|  |..|.|..:::..|.....|..:.|      ::.|.|.  :..|..|.:.|   :
Human    30 LDFGHIKKKRVEAIRGQILSKLRLTSPPEPTVMTHVPYQVLALYNSTR--ELLEEMHGERE---E 89

  Fly   587 YSVQTHDKNRYHEGRSSIGYQPAIHNIEYENQKGHHESFADDHENIDHEDFFGNTQEIITFAEEG 651
            ...|.:.::.|        |...||..:.......|...|...:.|..:.|..|...:       
Human    90 GCTQENTESEY--------YAKEIHKFDMIQGLAEHNELAVCPKGITSKVFRFNVSSV------- 139

  Fly   652 TQYRQYRILEFSAQNR--RVPSQKLSIRSAQIHIRIDKPHSLWIEKAKSLPEKHLLNTKRKWGAN 714
               .:.|...|.|:.|  |||:.. |.|:.|   ||:....|       .|::|:...:...|.|
Human   140 ---EKNRTNLFRAEFRVLRVPNPS-SKRNEQ---RIELFQIL-------RPDEHIAKQRYIGGKN 190

  Fly   715 KPHHRIKIWVFQLSTSINITEKGIDKAIIFRASFQVDPKNLGWQKFDLTDTIREW-YGHTSHEKL 778
            .|                  .:|..:                |..||:|||:||| ....|:..|
Human   191 LP------------------TRGTAE----------------WLSFDVTDTVREWLLRRESNLGL 221

  Fly   779 RLLIDCTGCGGRYSLHLFQTS-------------KLRG--NSSDY---------LSTNPNRPFLV 819
            .:.|.|. |      |.||.:             |.:|  |..|:         ...:.:.|.|:
Human   222 EISIHCP-C------HTFQPNGDILENIHEVMEIKFKGVDNEDDHGRGDLGRLKKQKDHHNPHLI 279

  Fly   820 L-----H--TESSRTRRVRRRAVD---CGGALNGQCCKESFYVSFKA-LGWDDWIIAPRGYFANY 873
            |     |  ....:..:.::||:|   |...|...||....|:.|:. ||| .|:..|:||:||:
Human   280 LMMIPPHRLDNPGQGGQRKKRALDTNYCFRNLEENCCVRPLYIDFRQDLGW-KWVHEPKGYYANF 343

  Fly   874 CRGDCTGSFRTPDTFQTFHAHFIEEYRKMGLMNGMRPCCAPIKFSSMSLIYYGDDGIIKRDLPKM 938
            |.|.|. ..|:.|   |.|:..:..|..:.......|||.|.....::::||.........|..|
Human   344 CSGPCP-YLRSAD---TTHSTVLGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNM 404

  Fly   939 VVDECGC 945
            ||..|.|
Human   405 VVKSCKC 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ActbetaNP_651942.2 TGFb_propeptide 370..>509 CDD:279078
TGF_beta 843..945 CDD:278448 32/102 (31%)
TGFB3NP_001316868.1 TGFb_propeptide 24..230 CDD:395559 57/274 (21%)
Cell attachment site. /evidence=ECO:0000250|UniProtKB:P01137 261..263 0/1 (0%)
TGF_beta_TGFB3 312..412 CDD:381656 33/105 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11848
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.