DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Actbeta and Bmp8a

DIOPT Version :9

Sequence 1:NP_651942.2 Gene:Actbeta / 43826 FlyBaseID:FBgn0024913 Length:946 Species:Drosophila melanogaster
Sequence 2:NP_001102902.1 Gene:Bmp8a / 680931 RGDID:1585858 Length:399 Species:Rattus norvegicus


Alignment Length:372 Identity:85/372 - (22%)
Similarity:142/372 - (38%) Gaps:101/372 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   622 HESFADDHENIDHEDFFGNTQEIITFA-----EEGTQYRQYRILEFSAQNRRVPSQKLSIRSAQI 681
            :.:..||.:....:...|....:::|.     :....|::....||.....::|:.: ::.:|:.
  Rat    80 YHAMTDDDDGGPPQAHLGRADLVMSFVNMVERDRTLGYQEPHWKEFHFDLTQIPAGE-AVTAAEF 143

  Fly   682 HIRIDKPHSLWIEKAKSLPEKHLLNTKRKWGANKPHHRIKIWVFQLSTSINITEKGIDKAIIFRA 746
            .|..:             |..|           .|:..:.|.:|::     :.|:...::.:|..
  Rat   144 RIYKE-------------PSTH-----------PPNTTLHISMFEV-----VQERSNRESDLFFL 179

  Fly   747 SFQ-VDPKNLGWQKFDLTDTIREW-YGHTSHEKLRLLIDCTGCGGRYSLHLFQTSKLRGNSSD-- 807
            ..| :...:.||...|:|.....| ..|.....|||.::...                |:|.|  
  Rat   180 DLQTLRSGDEGWLVLDITAASDRWLLNHNKDLGLRLYVETED----------------GHSLDPG 228

  Fly   808 ------YLSTNPNRPFLVLHTESS----RT----RRVRRR----------------AVDCGGALN 842
                  ..:....:||:|....:|    ||    |.::||                ..|.|....
  Rat   229 LAGLLGQTAPRSRQPFMVTFFRASSSPVRTPRAVRPLKRRQPKKTNELPHPNKLPGIFDDGHGSR 293

  Fly   843 GQ--CCKESFYVSFKALGWDDWIIAPRGYFANYCRGDCTGSFRTPDTFQTFHAHFIEEYRKMGLM 905
            |:  |.:...||||:.|||.||:|||:||.|.||.|:|....   |:......|.|.:    .|:
  Rat   294 GREVCRRHELYVSFRDLGWLDWVIAPQGYSAYYCEGECAFPL---DSCMNATNHAILQ----SLV 351

  Fly   906 NGMRP------CCAPIKFSSMSLIYY-GDDGIIKRDLPKMVVDECGC 945
            :.|:|      ||||.|.|:.|::|| ..:.:|.|....|||..|||
  Rat   352 HLMKPDVVPKACCAPTKLSATSVLYYDSSNNVILRKHRNMVVKACGC 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ActbetaNP_651942.2 TGFb_propeptide 370..>509 CDD:279078
TGF_beta 843..945 CDD:278448 42/110 (38%)
Bmp8aNP_001102902.1 TGFb_propeptide 32..248 CDD:279078 33/213 (15%)
TGF_beta 298..398 CDD:278448 41/106 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.