DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Actbeta and Bmp8b

DIOPT Version :9

Sequence 1:NP_651942.2 Gene:Actbeta / 43826 FlyBaseID:FBgn0024913 Length:946 Species:Drosophila melanogaster
Sequence 2:XP_002729572.1 Gene:Bmp8b / 679119 RGDID:1591873 Length:399 Species:Rattus norvegicus


Alignment Length:469 Identity:95/469 - (20%)
Similarity:168/469 - (35%) Gaps:160/469 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   527 PKELKSGAVRKVNGINGTQMNENALKKSTYP-------IDINHSIDNKTHTGKNGEMSHNDYEYF 584
            |::::. .:|:|.|:.|...:...|..:..|       :::.|::.:.:..|......|......
  Rat    40 PRDMQR-EIREVLGLPGRPRSRAPLATAQQPASAPLFMLNLYHAMTDDSGNGPPQPHLHRADLIM 103

  Fly   585 NDYSVQTHDKNRYHEGRSSIGYQPAIHNIEYENQKGHHESFADDHENIDHEDFFGNTQEIITFAE 649
            :..::..||:        ::||           |:.|.:.|..|...|.       ..|.:|.||
  Rat   104 SFVNIVEHDR--------TLGY-----------QEPHWKEFHFDLTQIP-------AGEAVTAAE 142

  Fly   650 EGTQYRQYRILEFSAQNRRVPSQKLSIRSAQIHIRIDKPHSLWIEKAKSLPEKHLLNTKRKWGAN 714
                :|.|:                                        .|..|           
  Rat   143 ----FRIYK----------------------------------------EPSTH----------- 152

  Fly   715 KPHHRIKIWVFQLSTSINITEKGIDKAIIFRASFQ-VDPKNLGWQKFDLTDTIREW-YGHTSHEK 777
            .|:..:.|.:|::     :.|:...::.:|....| :...:.||...|:|.....| ..|.....
  Rat   153 PPNTTLHISMFEV-----VQERSNRESDLFFLDLQTLRSGDEGWLVLDITAASDRWLLNHNKDLG 212

  Fly   778 LRLLIDCTGCGGRYSLHLFQTSKLRGNSSD--------YLSTNPNRPFLVLHTESSRT------- 827
            |||.::...                |:|.|        ..:....:||:|...::|::       
  Rat   213 LRLYVETED----------------GHSLDPGLAGLLGQTAPRSRQPFMVGFFKASQSPVRAPRT 261

  Fly   828 -RRVRRRAV-----------------DCGGALNGQCC-KESFYVSFKALGWDDWIIAPRGYFANY 873
             |.::::.:                 |..|:|:.:.| :...||||:.|||.|.:|||:||.|.|
  Rat   262 ARPLKKKKLNQVNQLPNSNKHLGIFDDGHGSLDREVCRRHELYVSFRDLGWLDSVIAPQGYSAYY 326

  Fly   874 CRGDCTGSFRTPDTFQTFHAHFIEEYRKMGLMNGMRP------CCAPIKFSSMSLIYYG-DDGII 931
            |.|:|.....:... .|.||      ....|::.|:|      ||.|.|.|::||:||. ::.:|
  Rat   327 CAGECIYPLNSCMN-STNHA------TMQALVHLMKPDIVPKVCCVPTKLSAISLLYYDRNNNVI 384

  Fly   932 KRDLPKMVVDECGC 945
            .|....|||..|||
  Rat   385 LRRERNMVVQACGC 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ActbetaNP_651942.2 TGFb_propeptide 370..>509 CDD:279078
TGF_beta 843..945 CDD:278448 40/109 (37%)
Bmp8bXP_002729572.1 TGFb_propeptide 32..248 CDD:279078 48/310 (15%)
TGF_beta 298..398 CDD:278448 40/106 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.