DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Actbeta and BMP8B

DIOPT Version :9

Sequence 1:NP_651942.2 Gene:Actbeta / 43826 FlyBaseID:FBgn0024913 Length:946 Species:Drosophila melanogaster
Sequence 2:XP_011540326.2 Gene:BMP8B / 656 HGNCID:1075 Length:427 Species:Homo sapiens


Alignment Length:385 Identity:100/385 - (25%)
Similarity:147/385 - (38%) Gaps:112/385 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   627 DDHENIDHEDFFGNTQEIITFA-----EEGTQYRQYRILEFSAQNRRVPSQKLSIRSAQIHIRID 686
            ||.:....|...|....:::|.     :....:::....||.....::|:.: ::.:|:..|   
Human    88 DDEDGAPAERRLGRADLVMSFVNMVERDRALGHQEPHWKEFRFDLTQIPAGE-AVTAAEFRI--- 148

  Fly   687 KPHSLWIEKAKSLPEKHLLNTKRKWGANKPHHRIKIWVFQLSTSINITEKGIDKAIIFRASFQ-V 750
                      ..:|..||||           ..:.:.:||:     :.|:...::.:|....| :
Human   149 ----------YKVPSIHLLN-----------RTLHVSMFQV-----VQEQSNRESDLFFLDLQTL 187

  Fly   751 DPKNLGWQKFDLTDTIREWYGHTSHEK--LRLLIDC------TGCGGRYSLHLFQTSKLRGNSSD 807
            ...:.||...|:|.....|. ...|:.  |||.::.      ||.|......| |..|||     
Human   188 RAGDEGWLVLDVTAASDCWL-LKRHKDLGLRLYVETEDGETWTGWGWTKDSRL-QMWKLR----- 245

  Fly   808 YLSTNP---------------NRPFLVL---HTESS----RT----RRVRRRAV----------- 835
             ||..|               .||.|.|   |..:|    ||    |.:|||..           
Human   246 -LSRTPWVLSLHAPGPAQAPAERPLLCLLQGHCPASPSPIRTPRAVRPLRRRQPKKSNELPQANR 309

  Fly   836 ------DCGGALNGQCC-KESFYVSFKALGWDDWIIAPRGYFANYCRGDCTGSFRTPDTFQ-TFH 892
                  |..|:...|.| :...||||:.|||.||:|||:||.|.||.|:|  ||....... |.|
Human   310 LPGIFDDVHGSHGRQVCRRHELYVSFQDLGWLDWVIAPQGYSAYYCEGEC--SFPLDSCMNATNH 372

  Fly   893 AHFIEEYRKMGLMNGMRP------CCAPIKFSSMSLIYY-GDDGIIKRDLPKMVVDECGC 945
            |..      ..|::.|.|      ||||.|.|:.|::|| ..:.:|.|....|||..|||
Human   373 AIL------QSLVHLMMPDAVPKACCAPTKLSATSVLYYDSSNNVILRKHRNMVVKACGC 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ActbetaNP_651942.2 TGFb_propeptide 370..>509 CDD:279078
TGF_beta 843..945 CDD:278448 44/110 (40%)
BMP8BXP_011540326.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.