DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Actbeta and BMP3

DIOPT Version :9

Sequence 1:NP_651942.2 Gene:Actbeta / 43826 FlyBaseID:FBgn0024913 Length:946 Species:Drosophila melanogaster
Sequence 2:NP_001192.4 Gene:BMP3 / 651 HGNCID:1070 Length:472 Species:Homo sapiens


Alignment Length:338 Identity:81/338 - (23%)
Similarity:128/338 - (37%) Gaps:100/338 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   682 HIRIDKPHSLWIEKAKSLPEKHLLNTKRKWGANKPHHRIKIWVFQLSTSI--------------N 732
            ||:||.  |.|..|. |..:..||. .......|.|..|..|:.:..|.:              |
Human   160 HIQIDL--SAWTLKF-SRNQSQLLG-HLSVDMAKSHRDIMSWLSKDITQLLRKAKENEEFLIGFN 220

  Fly   733 ITEKG-------------------IDKAIIFRASFQVDPKNL-----GWQKFDLTDTIREWYGHT 773
            ||.||                   .|.||       .:|:::     |.:.|. |.|:.:|   .
Human   221 ITSKGRQLPKRRLPFPEPYILVYANDAAI-------SEPESVVSSLQGHRNFP-TGTVPKW---D 274

  Fly   774 SHEKLRLLID-----CTGCGGRYSLHLFQTSKLRGNSSDYLST---NPNRPFLVLHT---ESSRT 827
            ||.:..|.|:     .||.     |...|.::|.|....|...   ...:|:..|..   |.|:.
Human   275 SHIRAALSIERRKKRSTGV-----LLPLQNNELPGAEYQYKKDEVWEERKPYKTLQAQAPEKSKN 334

  Fly   828 RRVRRRAVDCGGALNGQ----------------------CCKESFYVSFKALGWDDWIIAPRGYF 870
            ::.:|:    |.....|                      |.:....|.|..:||.:|||:|:.:.
Human   335 KKKQRK----GPHRKSQTLQFDEQTLKKARRKQWIEPRNCARRYLKVDFADIGWSEWIISPKSFD 395

  Fly   871 ANYCRGDCTGSFRTPDTFQ-TFHAHFIEEYRKMGLMNGM-RPCCAPIKFSSMSLIYYGDD-GIIK 932
            |.||.|.|  .|..|.:.: :.||......|.:|::.|: .|||.|.|.||:|::::.:: .::.
Human   396 AYYCSGAC--QFPMPKSLKPSNHATIQSIVRAVGVVPGIPEPCCVPEKMSSLSILFFDENKNVVL 458

  Fly   933 RDLPKMVVDECGC 945
            :..|.|.|:.|.|
Human   459 KVYPNMTVESCAC 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ActbetaNP_651942.2 TGFb_propeptide 370..>509 CDD:279078
TGF_beta 843..945 CDD:278448 34/126 (27%)
BMP3NP_001192.4 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..53
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 320..350 7/33 (21%)
TGF_beta_BMP3 363..472 CDD:381663 34/111 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11848
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.