DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Actbeta and BMP2

DIOPT Version :9

Sequence 1:NP_651942.2 Gene:Actbeta / 43826 FlyBaseID:FBgn0024913 Length:946 Species:Drosophila melanogaster
Sequence 2:NP_001191.1 Gene:BMP2 / 650 HGNCID:1069 Length:396 Species:Homo sapiens


Alignment Length:397 Identity:89/397 - (22%)
Similarity:145/397 - (36%) Gaps:126/397 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   593 DKNRYHEGRSSIGYQPAIHNIEYENQKG------HHESFADDHENIDHED---FFGN-----TQE 643
            |..|.|.|:.  |.....|.:|....:.      |||...::......:.   ||.|     |:|
Human    81 DLYRRHSGQP--GSPAPDHRLERAASRANTVRSFHHEESLEELPETSGKTTRRFFFNLSSIPTEE 143

  Fly   644 IITFAEEGTQYRQYRILEFSAQNRRVPSQKLSIRSAQIHIRIDKPHSLWIEKAKSLPEKHLLNTK 708
            .||.||                        |.:...|:...:....|.                 
Human   144 FITSAE------------------------LQVFREQMQDALGNNSSF----------------- 167

  Fly   709 RKWGANKPHHRIKIWVFQLSTSIN----ITEKGIDKAIIFRASFQVDPKNLGWQKFDLTDTIREW 769
                    ||||.|:......:.|    :| :.:|..::.:.:.:       |:.||:|..:..|
Human   168 --------HHRINIYEIIKPATANSKFPVT-RLLDTRLVNQNASR-------WESFDVTPAVMRW 216

  Fly   770 --YGHTSH---EKLRLLIDCTGCGGRY-----SLHLFQTSKLRGNSSDYLSTNPNRPFLV----- 819
              .||.:|   .::..|.:..|...|:     |||           .|..|.:..||.||     
Human   217 TAQGHANHGFVVEVAHLEEKQGVSKRHVRISRSLH-----------QDEHSWSQIRPLLVTFGHD 270

  Fly   820 -----LHTESSRTRRVRRRAVDCGGALNGQCCKESFYVSFKALGWDDWIIAPRGYFANYCRGDCT 879
                 ||....|..:.::|.     .|...|.:...||.|..:||:|||:||.||.|.||.|:| 
Human   271 GKGHPLHKREKRQAKHKQRK-----RLKSSCKRHPLYVDFSDVGWNDWIVAPPGYHAFYCHGEC- 329

  Fly   880 GSFRTPDTFQTFHAHFIEEYRKMGLMNGM-----RPCCAPIKFSSMSLIYYGD-DGIIKRDLPKM 938
             .|...|...:.:...::.     |:|.:     :.||.|.:.|::|::|..: :.::.::...|
Human   330 -PFPLADHLNSTNHAIVQT-----LVNSVNSKIPKACCVPTELSAISMLYLDENEKVVLKNYQDM 388

  Fly   939 VVDECGC 945
            ||:.|||
Human   389 VVEGCGC 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ActbetaNP_651942.2 TGFb_propeptide 370..>509 CDD:279078
TGF_beta 843..945 CDD:278448 32/107 (30%)
BMP2NP_001191.1 TGFb_propeptide 37..267 CDD:279078 50/255 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 84..121 9/38 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 271..293 4/26 (15%)
TGFB 296..396 CDD:214556 34/107 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.