DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Actbeta and Inhbc

DIOPT Version :9

Sequence 1:NP_651942.2 Gene:Actbeta / 43826 FlyBaseID:FBgn0024913 Length:946 Species:Drosophila melanogaster
Sequence 2:NP_072136.1 Gene:Inhbc / 64549 RGDID:621194 Length:351 Species:Rattus norvegicus


Alignment Length:333 Identity:83/333 - (24%)
Similarity:124/333 - (37%) Gaps:109/333 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   643 EIITFAEEGTQYRQYRILEFSAQNRRVPSQKLSIRSAQIHIRIDKPHSLWIEKAKSLPEKHLLNT 707
            |||:||:.|........|||...:|.....:                              :|.|
  Rat    97 EIISFADTGLSNINQTRLEFHFSDRTTGGVE------------------------------VLQT 131

  Fly   708 KRKWGANKPHHRIKIWVFQLSTSINITEKGIDKAIIFRASFQVDPKNLGWQKFDLTDTIREWYGH 772
            :              ::|.:....|.|:....:.::.|             .:|...|:...|  
  Rat   132 R--------------FMFFMQLPPNTTQTMNIRVLVLR-------------PYDTNLTLTSQY-- 167

  Fly   773 TSHEKLRLLIDCTG-------------CG-GRYSLHLFQTSKLRGNSSDYLSTNPNRPFLVLHTE 823
                  .|.:|.:|             |. |..:|.|...|:| .:||..|....:|||:.....
  Rat   168 ------MLQVDASGWYQLLLGPEAQAACSQGHLTLELVPESQL-AHSSLILDGVSHRPFVAAQVR 225

  Fly   824 SSRTRRVRRRAVDCGGALNGQCCKESFYVSFKALGWDDWIIAPRGYFANYCRGDC----TGSFRT 884
            .....|||||.::|.| |:..||::.|:|.|:.:||.||||.|.||..|:|.|.|    .|   .
  Rat   226 VEGKHRVRRRGINCQG-LSRMCCRQEFFVDFREIGWHDWIIQPEGYAMNFCTGQCPLHVAG---M 286

  Fly   885 PDTFQTFHAHFIEEYRKMGLMNGMR-----------PCCAPIKFSSMSLIYYG-DDGIIKRDLPK 937
            |....:||.         .::|.::           .||.|.....:||:||. |..|:|.|:|.
  Rat   287 PGISASFHT---------AVLNLLKANTDAGTARRGSCCVPTSRRPLSLLYYDRDSNIVKTDIPD 342

  Fly   938 MVVDECGC 945
            |||:.|||
  Rat   343 MVVEACGC 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ActbetaNP_651942.2 TGFb_propeptide 370..>509 CDD:279078
TGF_beta 843..945 CDD:278448 39/117 (33%)
InhbcNP_072136.1 TGF_beta_INHBC_E 246..351 CDD:381676 41/117 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 118 1.000 Domainoid score I5700
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1385831at2759
OrthoFinder 1 1.000 - - FOG0000887
OrthoInspector 1 1.000 - - otm45057
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11848
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X477
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.920

Return to query results.
Submit another query.