DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Actbeta and Gdf9

DIOPT Version :9

Sequence 1:NP_651942.2 Gene:Actbeta / 43826 FlyBaseID:FBgn0024913 Length:946 Species:Drosophila melanogaster
Sequence 2:NP_067704.1 Gene:Gdf9 / 59304 RGDID:71038 Length:440 Species:Rattus norvegicus


Alignment Length:373 Identity:78/373 - (20%)
Similarity:135/373 - (36%) Gaps:99/373 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   641 TQEIITFAEEGTQYRQYRILEFSAQNRRVPSQKLS--IRSAQIHIRIDKPHSLWIEKAKSLPEKH 703
            |:|.:........|...|:....||..:.||.:::  :....:...:|:..::          :|
  Rat    98 TKEGVPKPSRSHLYNTVRLFSPCAQQEQAPSNQMTGPLPMVDLLFNLDRVTAM----------EH 152

  Fly   704 LLNTKRKWGANKPHHRIKIWVFQLSTS------------INITEKGIDKAIIFRASFQVDPKNLG 756
            ||.:              :.::.|:.|            :.:.|.........||.:....:...
  Rat   153 LLKS--------------VLLYTLNNSAASSSTVTCVCDLVVKEPMSSSKATPRAPYSFTLRKHR 203

  Fly   757 WQKFDLTDTIREWYGHTSHEKLRLLIDCTGC-------GGRYS----------LHLFQTSKLRGN 804
            |.:.|:|..::.... :|...:.|.::.| |       .|.::          |:|..||....:
  Rat   204 WIEMDVTSLLQPLVA-SSERSIHLSVNFT-CTRDQAPENGTFNMPLSVPPSLILYLNDTSTQAYH 266

  Fly   805 SSDYL------STNP------NRPFLVLHTESSRTRRVRR----------RAVDCGGALN----- 842
            |...|      |.:|      .||.....||..|:.|.||          :.:.....|:     
  Rat   267 SWQSLQSTQRHSQHPGQDSVTTRPVEEEATEVERSPRHRRGQKTLSSETKKPLTASFNLSEYFRQ 331

  Fly   843 -----GQCCKESFYVSFKALGWDDWIIAPRGYFANYCRGDCTGSFR----TPDTFQTFHAHFIEE 898
                 .:|....|.:||..|.||:||:||..|...||:|||..:.|    :|  ..|...:.|  
  Rat   332 FLFPQNECELHDFRLSFSQLKWDNWIVAPHRYNPRYCKGDCPRAVRHRYGSP--VHTMVQNII-- 392

  Fly   899 YRKMGLMNGMRPCCAPIKFSSMSLIYYGDDG-IIKRDLPKMVVDECGC 945
            |.|:. .:..||.|.|.|:|.:|::....|| |..::...|:...|.|
  Rat   393 YEKLD-PSVPRPSCVPGKYSPLSVLTIEPDGSIAYKEYEDMIATRCTC 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ActbetaNP_651942.2 TGFb_propeptide 370..>509 CDD:279078
TGF_beta 843..945 CDD:278448 35/106 (33%)
Gdf9NP_067704.1 TGF_beta 337..439 CDD:278448 35/106 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.