DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Actbeta and Bmp15

DIOPT Version :9

Sequence 1:NP_651942.2 Gene:Actbeta / 43826 FlyBaseID:FBgn0024913 Length:946 Species:Drosophila melanogaster
Sequence 2:NP_067702.1 Gene:Bmp15 / 59302 RGDID:70990 Length:391 Species:Rattus norvegicus


Alignment Length:293 Identity:83/293 - (28%)
Similarity:117/293 - (39%) Gaps:72/293 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   681 IHIRIDKPHSLWIEKAKSLPEKHLLNTKRKWGANKPHHRIKIWVFQLSTSINIT---------EK 736
            :|..:......|:.|.::   ||.   ..|.|:.||....|.|     ..:|||         .|
  Rat   142 VHYHLSCHVEPWVPKCRT---KHF---PSKSGSAKPSSVSKAW-----REMNITHCIQQKLWNRK 195

  Fly   737 GIDKAIIFRASFQVDPKNLGWQKFDLTDTIREWYGHTSHEKLRLLI--DCTGCGGRYSLHLFQTS 799
            |   ..:.|..|....     ||.:.|..:| |:|.||.:...||:  |.|....:        :
  Rat   196 G---RRVLRLRFMCQQ-----QKGNETLELR-WHGMTSLDVAFLLLYFDDTDESAQ--------A 243

  Fly   800 KLRGNSSDYLSTNPNRPFLVLHTESSRTRRVRRRA-----VDCGG-----ALNGQCCKESFYVSF 854
            ||.....:.| |:...|||:        |.||:..     |.|..     ::|.||....:.|||
  Rat   244 KLLARGQEEL-TDRESPFLM--------RSVRQTCSIASDVPCPSQEQDRSVNNQCSLHPYKVSF 299

  Fly   855 KALGWDDWIIAPRGYFANYCRGDCTG----SFRTPDTFQTFHAHFIEEYRKMGLMNGMRP--CCA 913
            ..||||.||||||.|..|||:|.|||    ...:|:       |.|.:.....|:|...|  .|.
  Rat   300 HQLGWDHWIIAPRLYTPNYCKGICTGVLPYGLNSPN-------HAIIQSLVNELVNRSVPQLSCV 357

  Fly   914 PIKFSSMSLIYYGDDG-IIKRDLPKMVVDECGC 945
            |.||..||::....:| |:.::...|:...|.|
  Rat   358 PYKFLPMSILLIEANGSILYKEYEGMIAQSCTC 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ActbetaNP_651942.2 TGFb_propeptide 370..>509 CDD:279078
TGF_beta 843..945 CDD:278448 39/108 (36%)
Bmp15NP_067702.1 TGF_beta 288..390 CDD:278448 39/108 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.