DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Actbeta and Tgfb1

DIOPT Version :9

Sequence 1:NP_651942.2 Gene:Actbeta / 43826 FlyBaseID:FBgn0024913 Length:946 Species:Drosophila melanogaster
Sequence 2:NP_067589.1 Gene:Tgfb1 / 59086 RGDID:69051 Length:390 Species:Rattus norvegicus


Alignment Length:352 Identity:84/352 - (23%)
Similarity:122/352 - (34%) Gaps:117/352 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   627 DDHENIDHEDF-FGNTQEIITFAEEGTQYRQYRILEFSAQNRRVPSQKLSIRSAQIHIRIDKPHS 690
            |..::|.|..: |.||.:|                     ...||...|..|:           .
  Rat   122 DKTKDITHSIYMFFNTSDI---------------------REAVPEPPLLSRA-----------E 154

  Fly   691 LWIEKAKSLPEKHLLNTKRKWGANKPHHRIKIWVF---QLSTSINITEKGIDKAIIFRASFQVDP 752
            |.:::.||..|:| :...:|:..|.       |.:   :|.|..:..|                 
  Rat   155 LRLQRFKSTVEQH-VELYQKYSNNS-------WRYLGNRLLTPTDTPE----------------- 194

  Fly   753 KNLGWQKFDLTDTIREWYGHTSHEKLRLLIDCTGCGGRYSLHLFQTS--------------KLRG 803
                |..||:|..:|:|.......:          |.|:|.|....|              |.||
  Rat   195 ----WLSFDVTGVVRQWLNQGDGIQ----------GFRFSAHCSCDSKDNVLHVEINGISPKRRG 245

  Fly   804 NSSDYLST--NPNRPFLVL---------HTESSRTRRVRRRAVD---CGGALNGQCCKESFYVSF 854
            :    |.|  :.|||||:|         |..|||    .|||:|   |..:....||....|:.|
  Rat   246 D----LGTIHDMNRPFLLLMATPLERAQHLHSSR----HRRALDTNYCFSSTEKNCCVRQLYIDF 302

  Fly   855 -KALGWDDWIIAPRGYFANYCRGDCTGSFRTPDTFQTFHAHFIEEYRKMGLMNGMRPCCAPIKFS 918
             |.||| .||..|:||.||:|.|.|...:    :..|.::..:..|.:........|||.|....
  Rat   303 RKDLGW-KWIHEPKGYHANFCLGPCPYIW----SLDTQYSKVLALYNQHNPGASASPCCVPQALE 362

  Fly   919 SMSLIYYGDDGIIKRDLPKMVVDECGC 945
            .:.::||.........|..|:|..|.|
  Rat   363 PLPIVYYVGRKPKVEQLSNMIVRSCKC 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ActbetaNP_651942.2 TGFb_propeptide 370..>509 CDD:279078
TGF_beta 843..945 CDD:278448 30/102 (29%)
Tgfb1NP_067589.1 TGFb_propeptide 30..261 CDD:395559 43/213 (20%)
Straightjacket domain. /evidence=ECO:0000250|UniProtKB:P07200 30..74
Arm domain. /evidence=ECO:0000250|UniProtKB:P07200 75..271 44/223 (20%)
Bowtie tail. /evidence=ECO:0000250|UniProtKB:P01137 226..252 6/29 (21%)
Cell attachment site. /evidence=ECO:0000255 244..246 1/1 (100%)
TGF_beta_TGFB1 292..390 CDD:381654 31/103 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11848
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.