DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Actbeta and inha

DIOPT Version :9

Sequence 1:NP_651942.2 Gene:Actbeta / 43826 FlyBaseID:FBgn0024913 Length:946 Species:Drosophila melanogaster
Sequence 2:NP_001038669.1 Gene:inha / 570520 ZFINID:ZDB-GENE-060503-554 Length:347 Species:Danio rerio


Alignment Length:250 Identity:63/250 - (25%)
Similarity:96/250 - (38%) Gaps:73/250 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   723 WVFQLST--SINITEKGI----DKAIIFRASFQVDPKNLGWQKFDLTDTIREWYGHT--SHEKLR 779
            |.:...|  ||||:....    :|.::..:...|.....||..:.|     :.:.||  :..:..
Zfish   143 WFYAGETIASINISAPLFILTHNKELLKASESPVKRSPDGWTTYKL-----DVHLHTPMADGQFM 202

  Fly   780 LLIDCTGCGGRYSLHLFQTSKLRGNSSDYLSTNPNRPFLVLHTESSRTRRVRR------------ 832
            |.|.|..|    |.|         :|.|      ..|||.|||.||...|.||            
Zfish   203 LQIRCPTC----SCH---------DSED------KTPFLHLHTRSSGPDRSRRAPKIPWSPDAIE 248

  Fly   833 ---RAVDCGGALNGQCCKESFYVSFKALGWDDWIIAPRGYFANYCRGDCTGSFRTPDTFQTFHAH 894
               |....|    ..|.:|...:||:.|||::||:.|:.:...||.|:|:.:             
Zfish   249 NLKRPASQG----TDCRREQIEISFEDLGWNNWIVHPKSFTFYYCHGNCSSA------------- 296

  Fly   895 FIEEYRKMGLMNGMRPCCAPIKFSSMSLIY--YGDDGIIKR--DLPKMVVDECGC 945
                 .::..:.|:..||||:..|..||.:  ..|.|...:  .||.::.:||.|
Zfish   297 -----ERITTILGITQCCAPVPESMKSLRFTTTSDGGYSFKYETLPNIIPEECNC 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ActbetaNP_651942.2 TGFb_propeptide 370..>509 CDD:279078
TGF_beta 843..945 CDD:278448 28/105 (27%)
inhaNP_001038669.1 TGF_beta 258..346 CDD:278448 28/105 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11848
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.