DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Actbeta and gdf10a

DIOPT Version :9

Sequence 1:NP_651942.2 Gene:Actbeta / 43826 FlyBaseID:FBgn0024913 Length:946 Species:Drosophila melanogaster
Sequence 2:XP_691459.3 Gene:gdf10a / 563003 ZFINID:ZDB-GENE-090312-17 Length:441 Species:Danio rerio


Alignment Length:485 Identity:90/485 - (18%)
Similarity:147/485 - (30%) Gaps:203/485 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   576 MSHNDYEYFNDYSVQTHDKNRYHEGRSSIGYQPAIHNIEYENQKGHHESFADDHENIDHEDFFGN 640
            :|.:.|:.:..|:.   :.||..||.:.                   .||....||::       
Zfish    44 LSQHMYKLYEKYNT---EPNRLKEGNTV-------------------RSFKAKPENVE------- 79

  Fly   641 TQEIITFAEEGTQYRQYRILEFSAQNRRVPSQKLSIRSAQIHIRIDK-PHSLWIEKAKSLPEKHL 704
                        |...||:...|.|...|      |.|:..|...|| |.               
Zfish    80 ------------QRVSYRLNLTSLQGSEV------ILSSTFHFFFDKRPR--------------- 111

  Fly   705 LNTKRKWGANK---PHHRI-------KIWVFQLSTSINITEKGIDKAIIFRASFQVDPKNLG-WQ 758
               :|.|...:   |..||       .|.:...|.|:|.|...:      ..:..|.|...| ||
Zfish   112 ---QRSWFCKRFKNPSCRITNFPLLPSIRLLFRSPSVNSTTGSL------LGNLTVVPHRRGTWQ 167

  Fly   759 KFDLTDTIREWYGHTSHEKLRLLIDCT-GCGGRYSLHLFQTSK-----LRGNSSDYLSTNPNR-- 815
            ..|::..::|     :.::.:|||... ..|.:|..:..|.|.     |...::|...:.||.  
Zfish   168 SKDVSVIMKE-----ARDRNQLLITLEFDYGEQYQRYQDQLSPSTLPYLLVYANDLAISEPNSVA 227

  Fly   816 -------PFL------------------------------------------------------- 818
                   ||:                                                       
Zfish   228 VSLQRYDPFIGDQQPAQSPDSSPDIRVKRELELDFTDPIENNELPEVEYNSFKQHDMWESAYYPL 292

  Fly   819 ------------------------VLHTESSRTRRVRRRAVDCGGALNGQ------CCKESFYVS 853
                                    ||..:....::.|||          |      |.:....|.
Zfish   293 KPKPFKKERRRKGQEHTDGFGKSQVLRFDEKTMKKARRR----------QWKEPRSCSRRYLKVD 347

  Fly   854 FKALGWDDWIIAPRGYFANYCRGDCTGSFRTPDTFQ-TFHAHFIEEYRKMGLMNGM-RPCCAPIK 916
            |..:||::||::|:.:.|.||.|.|  .|..|...: :.||......:.:|::.|: .|||.|.|
Zfish   348 FADIGWNEWILSPKSFDAFYCAGTC--EFPIPKVVRPSNHATIQSIVKAVGIIPGIPEPCCVPEK 410

  Fly   917 FSSMSLIYYGDD-GIIKRDLPKMVVDECGC 945
            ...:|:::..:. .|:.:..|.|.|:.|.|
Zfish   411 MKPLSVLFVDESKNIVLKIYPNMSVETCAC 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ActbetaNP_651942.2 TGFb_propeptide 370..>509 CDD:279078
TGF_beta 843..945 CDD:278448 31/110 (28%)
gdf10aXP_691459.3 TGF_beta 337..440 CDD:278448 30/104 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11848
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.