DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Actbeta and bmp8a

DIOPT Version :9

Sequence 1:NP_651942.2 Gene:Actbeta / 43826 FlyBaseID:FBgn0024913 Length:946 Species:Drosophila melanogaster
Sequence 2:NP_001038436.1 Gene:bmp8a / 561963 ZFINID:ZDB-GENE-030912-13 Length:433 Species:Danio rerio


Alignment Length:275 Identity:77/275 - (28%)
Similarity:111/275 - (40%) Gaps:73/275 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   711 WGANKPHHRIKIWVFQLSTSINITEKGIDKAIIFRASFQVDPKNL-GWQKFDLTDTIREWYGH-T 773
            |..|   |.:.|.|:::     :.||...:..:.....|..|... ||..||:|.....|..| .
Zfish   191 WRFN---HTLHISVYEI-----LREKRHREPELVLLDMQSVPAGQEGWLAFDVTSASNRWLLHPR 247

  Fly   774 SHEKLRLLIDC-------TGCGGR--------YSLHLFQTSKL-------------RGNSSDYLS 810
            |:..:||.::.       .|..||        :.:..|:.|:.             |...:.|..
Zfish   248 SNLGIRLYVETEEDHRSWVGLVGRRGPRSKQPFMVTFFRASQAPCRPPRALKHTNQRKKKTKYDL 312

  Fly   811 TNPNRPFLVLHTESSRTRRVRRRAVDCGGALNGQCCKESFYVSFKALGWDDWIIAPRGYFANYCR 875
            .:||||.:.....||     .|:|          |.|...||||..|||.||::||.||.|.||.
Zfish   313 PHPNRPGIFDQNHSS-----GRQA----------CKKHELYVSFSDLGWKDWVLAPTGYSAYYCD 362

  Fly   876 GDC---TGSFRTPDTFQTFHAHFIEEYRKMGLMNGMRP------CCAPIKFSSMSLIYYGD-DGI 930
            |:|   .||...    .|.||..      ..|::.:||      ||||.|.|.:::::|.| :.:
Zfish   363 GECDYPLGSCMN----ATNHAMI------QLLVHLLRPDEVPKACCAPTKLSPIAVLFYDDNNNV 417

  Fly   931 IKRDLPKMVVDECGC 945
            |.:....|||..|||
Zfish   418 ILKKQRNMVVKNCGC 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ActbetaNP_651942.2 TGFb_propeptide 370..>509 CDD:279078
TGF_beta 843..945 CDD:278448 41/111 (37%)
bmp8aNP_001038436.1 TGFb_propeptide 46..284 CDD:279078 22/100 (22%)
TGFB 332..432 CDD:214556 41/109 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.