DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Actbeta and tgfb5

DIOPT Version :9

Sequence 1:NP_651942.2 Gene:Actbeta / 43826 FlyBaseID:FBgn0024913 Length:946 Species:Drosophila melanogaster
Sequence 2:XP_021336789.1 Gene:tgfb5 / 559723 ZFINID:ZDB-GENE-130425-3 Length:414 Species:Danio rerio


Alignment Length:433 Identity:89/433 - (20%)
Similarity:153/433 - (35%) Gaps:115/433 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   585 NDYSVQTHDKNRYHEGRSSI----------------GYQPA------IHNIEYE--NQKGHHESF 625
            :.|::..|...|....|..|                ..||.      ::|...|  .::..|...
Zfish    24 HSYNLDDHKSKRIEAVRGQILSKLRIRSPPDPEASPTPQPVPAEVMLLYNSTKELLKERARHAEA 88

  Fly   626 ADDHENIDHEDFFGNTQEIITF---------AEEGTQYRQYRILEFSAQNRRVPSQKLSIRSAQI 681
            |.:.|: ..||::....:.:..         ...|.|...:||:.|...|  |.....::..|:.
Zfish    89 ACERES-SEEDYYAKEVQRVNMMPLRTDTNSISPGPQSPYFRIVGFDVTN--VERNSSTLVKAEF 150

  Fly   682 HI-RIDKPHSLWIEKAKSLPEKHLLNTKRKWGANKPHHRIKIWVFQLSTSINIT---EKGIDKAI 742
            .| |...|.:...|:                         ::.::|:..|.::|   ::.||   
Zfish   151 RIFRAPNPQARATEQ-------------------------RVEIYQILKSEDVTAPSQRYID--- 187

  Fly   743 IFRASFQVDPKNLG-WQKFDLTDTIREWYGHTSHE-KLRLLIDCTGCGGRYSLH----------- 794
                |..|:|:..| |...|:|:|::||....... .|::.:.|..|....|.:           
Zfish   188 ----SRTVEPRAKGAWLSVDVTETVKEWMAFRERNLGLKISVHCPCCTFVPSTNNIVPNKSEELE 248

  Fly   795 ---------LFQTSKLRGNSSDYLSTNPNRPFLV--------LHTESSRTRRVRRRAVD---CGG 839
                     |.:.::..|.:...:..:...|.|:        |.:...:||: :|.|.|   |  
Zfish   249 ARFAGIDDDLIKQTRKPGVTKGQIEFSTKTPHLILTLLPTDRLDSPIKKTRK-KRSAADTSIC-- 310

  Fly   840 ALNGQ-CCKESFYVSFKA-LGWDDWIIAPRGYFANYCRGDCTGSFRTPDTFQTFHAHFIEEYRKM 902
            ..|.| ||..|.|:.|:. |.| .||..|:||.||:|.|:|...:...:.:..    .:..|.||
Zfish   311 TRNDQGCCLRSLYIDFRRDLNW-KWIHEPKGYKANFCAGNCPYLWSADNHYNM----ILPLYNKM 370

  Fly   903 GLMNGMRPCCAPIKFSSMSLIYYGDDGIIKRDLPKMVVDECGC 945
            .......|||.|.....::::|:.........|..|||..|.|
Zfish   371 NPEASASPCCVPQDLEPLTIVYFLGRTPRVEQLSNMVVRSCKC 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ActbetaNP_651942.2 TGFb_propeptide 370..>509 CDD:279078
TGF_beta 843..945 CDD:278448 31/103 (30%)
tgfb5XP_021336789.1 TGFb_propeptide 21..229 CDD:307025 43/239 (18%)
TGF_beta 317..413 CDD:306518 30/100 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11848
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.