DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Actbeta and gdf1

DIOPT Version :9

Sequence 1:NP_651942.2 Gene:Actbeta / 43826 FlyBaseID:FBgn0024913 Length:946 Species:Drosophila melanogaster
Sequence 2:NP_001016819.1 Gene:gdf1 / 549573 XenbaseID:XB-GENE-481419 Length:361 Species:Xenopus tropicalis


Alignment Length:267 Identity:68/267 - (25%)
Similarity:107/267 - (40%) Gaps:88/267 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   721 KIWVFQLSTSINITEKG-----IDKAIIFRASFQVDPKNLGWQKFDLTDTIREWYGHTSHEKLRL 780
            :::..:|..::.||.||     :.:.::...:|::..|::   .|:|||..:.|.....:..|.|
 Frog   140 RVFDLRLYRTLQITLKGMGRNKMSRKLLVAQTFRLLHKSV---FFNLTDVCQSWRDPLKNLGLVL 201

  Fly   781 LI--------------DCTGCGGRYSLHLFQTSKLRGNSSDYLSTNPNRPFLVLHT----ESSRT 827
            .|              :|..         |||         :|.|:     |::.|    :..|.
 Frog   202 EIFPIKEGSWLSTPKDECKD---------FQT---------FLYTS-----LMMVTLNPMQCKRP 243

  Fly   828 RRVRRRAVDCGGALNGQCCKESFYVSFKALGWDDWIIAPRGYFANYCRGDCTGSFRTPDTFQTFH 892
            || :|.........:..|.|...||.||.:||.:|:||||||.||||.|:|              
 Frog   244 RR-KRSYSKLPFTASNICKKRRLYVEFKDVGWQNWVIAPRGYMANYCYGEC-------------- 293

  Fly   893 AHFIEEYRKMGLMNGMR------------------PCCAPIKFSSMSLIYY-GDDGIIKRDLPKM 938
                 .|....::||..                  |||.|.|.|.:|:::| .:|.::.|....|
 Frog   294 -----PYPLTEILNGSNHAILQTLVHSIEPDDIPLPCCVPTKMSPISMLFYDNNDNVVLRHYENM 353

  Fly   939 VVDECGC 945
            .||||||
 Frog   354 AVDECGC 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ActbetaNP_651942.2 TGFb_propeptide 370..>509 CDD:279078
TGF_beta 843..945 CDD:278448 39/120 (33%)
gdf1NP_001016819.1 TGFb_propeptide <108..205 CDD:366248 15/67 (22%)
TGF_beta_GDF1_3_like 260..361 CDD:381642 41/120 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.