DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Actbeta and bmp6

DIOPT Version :9

Sequence 1:NP_651942.2 Gene:Actbeta / 43826 FlyBaseID:FBgn0024913 Length:946 Species:Drosophila melanogaster
Sequence 2:NP_001013357.1 Gene:bmp6 / 503761 ZFINID:ZDB-GENE-050306-42 Length:417 Species:Danio rerio


Alignment Length:515 Identity:120/515 - (23%)
Similarity:178/515 - (34%) Gaps:164/515 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   470 FNISKNNVYGKVLRNRSLERIDKKNSFLNGWTENRQLKINS-QIASMPIELKSHHNSSPKELKSG 533
            |.:..|.::.: ||::....:.|:...:.|.....:..:|| :..|.|:.:...:||...|.|| 
Zfish    27 FELQSNFIHRR-LRSQEKREMQKEILSILGLNHRPRPHLNSGKYNSAPLFMLDLYNSMSTEEKS- 89

  Fly   534 AVRKVNGINGTQMNENALKKSTYPIDINHSIDNKTHTGKNGEMSHNDYEYFNDYSVQTHDKNRYH 598
                                   .:|...|:...|   :....||:|.|:.:|..:.....|...
Zfish    90 -----------------------DVDQYRSLFTTT---RPALASHHDTEFLHDADMVMSFVNLVE 128

  Fly   599 EGRSSIGYQPAIHNIEYENQKGHHESFADDHENIDHEDFFGNTQEIITFAEEGTQYRQYRILEFS 663
            ..|            |...|:.||:.|..:...|..       .|.||.||    :|.|:....|
Zfish   129 NDR------------ELSLQRRHHKEFKFNLSQIPE-------GEAITAAE----FRIYKECVTS 170

  Fly   664 AQNRRVPSQKLSIRSAQIHIRIDKPHSLWIEKAKSLPEK----HLLNTKRKWGANKPHHRIKIWV 724
            |  .|..:..||:      .::...|          |::    .||.::|.|||.:         
Zfish   171 A--FRNETFLLSV------FQVVGEH----------PDRDADLFLLESRRLWGAEQ--------- 208

  Fly   725 FQLSTSINITEKGIDKAIIFRASFQVDPKNLGWQKFDLTDTIREWYGHTSHEKLRLLIDCTGCGG 789
                                           ||.:||:|.|...|. .:.|..|.|.|......|
Zfish   209 -------------------------------GWLEFDITATSNLWV-MSPHHNLGLQISVETSSG 241

  Fly   790 R--------------------YSLHLFQTSKLRGNSSDYLSTNPNRPFLVLHTESSRTRRVRRRA 834
            |                    :.:..|:.|::|..:|  .||...|            :|.|.|:
Zfish   242 RSISPKDAGLVGRDGALERQPFMVAFFKVSEVRIRTS--RSTGKQR------------QRNRNRS 292

  Fly   835 VDCGGALNG-------------QCCKESFYVSFKALGWDDWIIAPRGYFANYCRGDCTGSFRTPD 886
            .....|..|             .|.|...||||:.|.|.||||||.||.||||.|:|:..... .
Zfish   293 NSPQEASKGPAHTDYNSSDQKTACRKHDLYVSFRELSWQDWIIAPEGYAANYCDGECSFPLNA-H 356

  Fly   887 TFQTFHAHFIEEYRKMGLMNGMRPCCAPIKFSSMSLIYYGDD-GIIKRDLPKMVVDECGC 945
            ...|.||........|...|..:|||||.|..::|::||.|: .:|.:....|||..|||
Zfish   357 MNATNHAIVQTLVHLMNPENVPKPCCAPTKLHAISVLYYDDNSNVILKKYRNMVVRSCGC 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ActbetaNP_651942.2 TGFb_propeptide 370..>509 CDD:279078 6/38 (16%)
TGF_beta 843..945 CDD:278448 43/115 (37%)
bmp6NP_001013357.1 TGFb_propeptide 28..267 CDD:279078 63/348 (18%)
TGFB 316..417 CDD:214556 44/102 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.