DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Actbeta and Lefty1

DIOPT Version :9

Sequence 1:NP_651942.2 Gene:Actbeta / 43826 FlyBaseID:FBgn0024913 Length:946 Species:Drosophila melanogaster
Sequence 2:NP_001102550.1 Gene:Lefty1 / 498299 RGDID:1561867 Length:368 Species:Rattus norvegicus


Alignment Length:311 Identity:68/311 - (21%)
Similarity:111/311 - (35%) Gaps:77/311 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   659 ILEFSAQNRRVPSQKLSIRSAQIHIRIDKPHSLWIEKAKSLPEKHLLNTKRKWGANKPHH---RI 720
            :|.|..:.|..|:.:|    .|..:|:.:         :.:|...|...||.    .||.   |:
  Rat    98 LLVFGMEQRLPPNSEL----VQAVLRLFQ---------EPVPRTALRRQKRL----SPHSARARV 145

  Fly   721 KI-WVFQLSTSINITEKGIDKAIIFRASFQVDPKNLGWQKFDLTDTIREWYGHTSHEKLRLLIDC 784
            .| |       :...|.|.::..:..:.. |.....||:.||:|:.:..|. ..|..:..||:..
  Rat   146 TIEW-------LRFREDGSNRTALIDSRL-VSIHESGWKVFDVTEAVNFWQ-QLSRPRQPLLLQV 201

  Fly   785 T------GCGGRYSLHLFQTSKLRGNSSDYLSTNPNRPFLVLHTESSRTRRVRRRAVDCGGALN- 842
            :      | .|.:|.|.......:|...   ......|.|.|||...:         |.|...| 
  Rat   202 SVQREHLG-PGTWSAHKLVRFAAQGTPD---GKGLGEPQLELHTLDLK---------DYGAQGNC 253

  Fly   843 ---------GQCCKESFYVSFKALGW-DDWIIAPRGYFANYCRGDCTGSFRTPDTFQTFHAHFIE 897
                     .:||::..|:..:.:.| ::||:.|.|:....|.|.|   .:.|::. |....|: 
  Rat   254 DPETPVTEGTRCCRQEMYLDLQGMKWAENWILEPPGFLTYECVGSC---LQPPESL-TIRWPFL- 313

  Fly   898 EYRKMGLMNGMRPCCAPIKFSSMSLIYYGDDGIIKR---DLPKMVVDECGC 945
                     |.|.|.|....|...::...:||..:.   .||.|.|..|.|
  Rat   314 ---------GPRQCVASEMTSLPLIVSIKEDGRTRPQVVSLPNMRVQRCSC 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ActbetaNP_651942.2 TGFb_propeptide 370..>509 CDD:279078
TGF_beta 843..945 CDD:278448 26/105 (25%)
Lefty1NP_001102550.1 TGFb_propeptide 29..211 CDD:413528 29/139 (21%)
TGF_beta_LEFTY1_2 264..355 CDD:381636 26/104 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11848
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.