DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Actbeta and gdf9

DIOPT Version :9

Sequence 1:NP_651942.2 Gene:Actbeta / 43826 FlyBaseID:FBgn0024913 Length:946 Species:Drosophila melanogaster
Sequence 2:NP_001012383.1 Gene:gdf9 / 497643 ZFINID:ZDB-GENE-050221-7 Length:418 Species:Danio rerio


Alignment Length:343 Identity:80/343 - (23%)
Similarity:130/343 - (37%) Gaps:64/343 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   640 NTQEIITFAEEG-TQYRQYRILEFSAQNRRVPSQKLSIRSAQIHIRIDKPHSLWIEKAKSLPEKH 703
            ||..:||..||. .|.|::.:.:.|....||.||:..::|..:: ..|..|.........|..|.
Zfish   102 NTARLITPREECLKQNREFFMQDISYSLNRVRSQEHLLKSVLLY-SFDHNHLSPFSLLCYLDMKE 165

  Fly   704 LLNTKRKWGAN-------------KPHHRIKIWVFQLSTS----------------INIT--EKG 737
            ..::|.:..:|             :.|||   ||....||                ||:|  |..
Zfish   166 QKSSKDQMCSNHLGIQHSVPLLSFRVHHR---WVEVDVTSFLHPLIQAHKKDIHLLINLTCVEDM 227

  Fly   738 IDK--AIIFRASFQVDPKNLGWQKFDLTDTIREWYGHTSHEKLRLLIDCTGCGGRYSLHLFQTSK 800
            |.:  ..|.::..::.|::.....: |.||....|...|.:...:.:......|:.:|....:.:
Zfish   228 ISRPGGQIHKSPVELTPRSPSLLLY-LNDTSEVAYQRRSTQGRMVDLTSNHWDGKSTLWELTSRR 291

  Fly   801 LRGNSSDYLSTNPNRPFLVLHTESSRTRRVRRRAVDCGGALNGQCCKESFYVSFKALGWDDWIIA 865
            .||...   |:..:.|.||...|.:                ...|....|.||||.|..|.|||.
Zfish   292 RRGTLK---SSETSMPKLVPMYEFT----------------TDDCDLYDFRVSFKELKLDHWIIE 337

  Fly   866 PRGYFANYCRGDCTGS--FRTPDTFQTFHAHFIEEYRKMGLMNGMRPCCAPIKFSSMS-LIYYGD 927
            |:.|...||:|.|..:  |.......|...:.|  |.|:. .:..||.|.|.:::.:| |.:..|
Zfish   338 PKKYNPRYCKGSCPRNVGFMYGSPMHTMVQNLI--YEKLD-SSVPRPTCVPSEYNPLSVLTFEND 399

  Fly   928 DGIIKRDLPKMVVDECGC 945
            .....::..:|:..:|.|
Zfish   400 KSYAYKEYEEMIATKCAC 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ActbetaNP_651942.2 TGFb_propeptide 370..>509 CDD:279078
TGF_beta 843..945 CDD:278448 31/104 (30%)
gdf9NP_001012383.1 TGF_beta 317..417 CDD:278448 31/102 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.