DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Actbeta and NODAL

DIOPT Version :9

Sequence 1:NP_651942.2 Gene:Actbeta / 43826 FlyBaseID:FBgn0024913 Length:946 Species:Drosophila melanogaster
Sequence 2:NP_060525.3 Gene:NODAL / 4838 HGNCID:7865 Length:347 Species:Homo sapiens


Alignment Length:326 Identity:75/326 - (23%)
Similarity:116/326 - (35%) Gaps:113/326 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   671 SQKLSIRSAQIHIRIDKPHSLWIEKAKSLPEKHLLNTKRKWGANKPHHRIKIWVFQLSTSINITE 735
            ||:..:..|::.:::..|..|..|.:.::...|         ..||.                ||
Human    83 SQQEDLAWAELRLQLSSPVDLPTEGSLAIEIFH---------QPKPD----------------TE 122

  Fly   736 KGIDKAIIFRASFQVD---------PKNLGWQKFDLTDTIREWYGHT-SHEKLRLLIDCTGCGGR 790
            :..|..:   ..||:|         ..:||....::|..:.:|..|. :.||             
Human   123 QASDSCL---ERFQMDLFTVTLSQVTFSLGSMVLEVTRPLSKWLKHPGALEK------------- 171

  Fly   791 YSLHLFQTSKLRGNSSDYLSTNP-NRPFLVLHTESSRTRRVRRRAVDCGG------------ALN 842
                  |.|::.|.......|.| ....|:|::..|:.:|      ..||            |..
Human   172 ------QMSRVAGECWPRPPTPPATNVLLMLYSNLSQEQR------QLGGSTLLWEAESSWRAQE 224

  Fly   843 GQ--------------------CCKESFYVSFKALGWDDWIIAPRGYFANYCRGDCTGSFRTPDT 887
            ||                    |.|..|.|.|..:||..|||.|:.|.|..|.|:|...  ..:.
Human   225 GQLSWEWGKRHRRHHLPDRSQLCRKVKFQVDFNLIGWGSWIIYPKQYNAYRCEGECPNP--VGEE 287

  Fly   888 FQ-TFHAHFIEEYRKMGLMNGMRP------CCAPIKFSSMSLIYYGDDGIIKRDLPK-MVVDECG 944
            |. |.||:.      ..|:...:|      ||||:|...:|::|. |:|.:..|..| |:|:|||
Human   288 FHPTNHAYI------QSLLKRYQPHRVPSTCCAPVKTKPLSMLYV-DNGRVLLDHHKDMIVEECG 345

  Fly   945 C 945
            |
Human   346 C 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ActbetaNP_651942.2 TGFb_propeptide 370..>509 CDD:279078
TGF_beta 843..945 CDD:278448 39/129 (30%)
NODALNP_060525.3 TGFb_propeptide 29..166 CDD:279078 19/110 (17%)
TGFB 247..346 CDD:214556 37/107 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.