DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Actbeta and gdf11

DIOPT Version :9

Sequence 1:NP_651942.2 Gene:Actbeta / 43826 FlyBaseID:FBgn0024913 Length:946 Species:Drosophila melanogaster
Sequence 2:NP_998140.1 Gene:gdf11 / 406247 ZFINID:ZDB-GENE-040427-2 Length:390 Species:Danio rerio


Alignment Length:354 Identity:93/354 - (26%)
Similarity:140/354 - (39%) Gaps:101/354 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   622 HESFADD----HENIDHEDFFGNTQEIITFAEEGTQYRQYRILEFSAQNRRVPSQKLSIRSAQIH 682
            |..|..|    .:.||.:::...|:.:||.|.|                            .:..
Zfish   107 HHDFQGDASSLEDFIDADEYHATTESVITMASE----------------------------PEPL 143

  Fly   683 IRID-KPHSLWIEKAKSLPEKHLLNTKRKWGANKPHHRIKIWVF-----QLSTSI-------NIT 734
            :::| ||...:.:.:..|....:|             :.::||:     |.||..       .||
Zfish   144 VQVDGKPTCCFFKFSPKLMFTKVL-------------KAQLWVYLQPLKQTSTVYLQILRLKPIT 195

  Fly   735 EKGIDKAIIFRASFQVDPKNLGWQKFDLTDTIREWY--GHTSHEKLRLLIDCTGCGGRYSLHLFQ 797
            |:|.....|.....::|.:...||..|....::.|:  .||:..     ||         ::.:.
Zfish   196 EQGSRHIRIRSLKIELDSQAGHWQSIDFKHVLQNWFKQPHTNWG-----ID---------INAYD 246

  Fly   798 TSKLRGNSSDYLSTNPN----RPFL---VLHTESSRTRRVRRR-AVDCG-GALNGQCCKESFYVS 853
            .|   ||.....|..|.    :|||   :|.|    |:|.||. .:||. .:...:||:....|.
Zfish   247 ES---GNDLAVTSLGPGEEGLQPFLEVKILET----TKRSRRNLGLDCDEHSTESRCCRYPLTVD 304

  Fly   854 FKALGWDDWIIAPRGYFANYCRGDCTGSFRTPDTFQTF-HAHFIEEYRKMGLMNGMRPCCAPIKF 917
            |:|.|| ||||||:.|.||||.|.|...|     .|.: |.|.::.....|   ...|||.|.|.
Zfish   305 FEAFGW-DWIIAPKRYKANYCSGQCEYMF-----MQKYPHTHLVQHANPRG---SAGPCCTPTKM 360

  Fly   918 SSMSLIYYGD-DGIIKRDLPKMVVDECGC 945
            |.::::|:.| ..||...:|.||||.|||
Zfish   361 SPINMLYFNDKQQIIHGKIPGMVVDRCGC 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ActbetaNP_651942.2 TGFb_propeptide 370..>509 CDD:279078
TGF_beta 843..945 CDD:278448 41/103 (40%)
gdf11NP_998140.1 TGFb_propeptide 52..268 CDD:279078 40/218 (18%)
TGFB 296..390 CDD:214556 43/103 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.