DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Actbeta and GDF6

DIOPT Version :9

Sequence 1:NP_651942.2 Gene:Actbeta / 43826 FlyBaseID:FBgn0024913 Length:946 Species:Drosophila melanogaster
Sequence 2:NP_001001557.1 Gene:GDF6 / 392255 HGNCID:4221 Length:455 Species:Homo sapiens


Alignment Length:279 Identity:68/279 - (24%)
Similarity:98/279 - (35%) Gaps:109/279 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   750 VDPKN---LGWQKFDLTDTIREWYGHTSHEKLRLLIDCTGCGGRYSLHLFQTSKLRGNSSDYLST 811
            :||:.   .||:.||:      |.|.......:|.::.....|          :|....::..:.
Human   202 LDPQGAPPAGWEVFDV------WQGLRHQPWKQLCLELRAAWG----------ELDAGEAEARAR 250

  Fly   812 NPNRP---------------------FLVLHTESSRT---------------------------- 827
            .|.:|                     .||:.|.|.|.                            
Human   251 GPQQPPPPDLRSLGFGRRVRPPQERALLVVFTRSQRKNLFAEMREQLGSAEAAGPGAGAEGSWPP 315

  Fly   828 ---------------RRVRRRA-VDCGGALNG-----QCCKESFYVSFKALGWDDWIIAPRGYFA 871
                           ||.||.| ....|..:|     :|.|:..:|:||.||||||||||..|.|
Human   316 PSGAPDARPWLPSPGRRRRRTAFASRHGKRHGKKSRLRCSKKPLHVNFKELGWDDWIIAPLEYEA 380

  Fly   872 NYCRGDCTGSFRT---PDTFQTFHAHFIEEYRKMGLMNGMRP------CCAPIKFSSMSLIYY-G 926
            .:|.|.|....|:   |    |.|| .|:.     |||.|.|      ||.|.|.:.:|::|. .
Human   381 YHCEGVCDFPLRSHLEP----TNHA-IIQT-----LMNSMDPGSTPPSCCVPTKLTPISILYIDA 435

  Fly   927 DDGIIKRDLPKMVVDECGC 945
            .:.::.:....|||:.|||
Human   436 GNNVVYKQYEDMVVESCGC 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ActbetaNP_651942.2 TGFb_propeptide 370..>509 CDD:279078
TGF_beta 843..945 CDD:278448 42/116 (36%)
GDF6NP_001001557.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 29..93
TGFb_propeptide 79..281 CDD:395559 15/94 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 244..267 2/22 (9%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 300..351 7/50 (14%)
TGF_beta_GDF5_6_7 354..455 CDD:381644 43/111 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.