DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Actbeta and tgfb3

DIOPT Version :9

Sequence 1:NP_651942.2 Gene:Actbeta / 43826 FlyBaseID:FBgn0024913 Length:946 Species:Drosophila melanogaster
Sequence 2:NP_919367.2 Gene:tgfb3 / 369195 ZFINID:ZDB-GENE-030723-4 Length:410 Species:Danio rerio


Alignment Length:403 Identity:96/403 - (23%)
Similarity:147/403 - (36%) Gaps:109/403 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   600 GRSSIGYQP-AIHNIEYENQKG----HHESFADDHENIDHEDFFGNTQEIITFAEEGTQYRQYRI 659
            |.|.:.||. |::|...:...|    .|:|...|:...::            :|:|   ..::.:
Zfish    59 GPSQVPYQVLALYNSTRDLLDGFGKDRHQSCGQDNTETEY------------YAKE---IHKFNM 108

  Fly   660 LEFSAQNRRVPSQKLSIRSAQIHIRIDKPHSLWIEKAKSLPEKHLLNTKRK--WGANKPHHRIKI 722
            ::.|.:|..:|.....|.|......:            |:.||:..|..|.  .....|:     
Zfish   109 IQGSPENNDLPYCPKGITSKVFRFDV------------SIMEKNASNLFRAEFRALRMPN----- 156

  Fly   723 WVFQLSTSINITEKGIDKAIIFRASFQVDP------KNL------GWQKFDLTDTIREWY-GHTS 774
                ||||  .||:.|:...|.|....:..      ||:      .|..||:|:|:|||. ...:
Zfish   157 ----LSTS--RTEQRIELYQILRPDEHIGKQRYIGRKNVMIGGTDEWVSFDVTETVREWLTNRAT 215

  Fly   775 HEKLRLLIDCTGCGGRYSLHLFQTS-------------KLRGNSSDYLSTNP------------- 813
            :..|.:.:.|. |      |.|:.:             |.||  .|.....|             
Zfish   216 NLGLEISVHCP-C------HTFRPNGEIIENVNEALEVKFRG--MDVEDDGPIRSDMGRLKKPKE 271

  Fly   814 -NRPFLVL------HTESSRTRRVRRRAVD---CGGALNGQCCKESFYVSFKA-LGWDDWIIAPR 867
             |.|.|:|      ..:...|.|.|:||:|   |.......||....|:.|:. ||| .||..|:
Zfish   272 QNLPHLILMMLPPHRLDVLPTSRRRKRALDTKYCFSNYEENCCVRKLYIDFRQDLGW-RWIHEPK 335

  Fly   868 GYFANYCRGDCTGSFRTPDTFQTFHAHFIEEYRKMGLMNGMRPCCAPIKFSSMSLIYYGDDGIIK 932
            ||.||:|.|.|. ..|:.|   |.|:..:..|..:.......|||.|.....::::||.......
Zfish   336 GYHANFCSGPCP-YLRSAD---TTHSSLLSLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKV 396

  Fly   933 RDLPKMVVDECGC 945
            ..|..|:|..|.|
Zfish   397 EQLSNMIVKSCKC 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ActbetaNP_651942.2 TGFb_propeptide 370..>509 CDD:279078
TGF_beta 843..945 CDD:278448 32/102 (31%)
tgfb3NP_919367.2 TGFb_propeptide 22..228 CDD:279078 45/213 (21%)
TGF_beta 311..409 CDD:278448 32/102 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11848
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.